The domain within your query sequence starts at position 199 and ends at position 266; the E-value for the t_SNARE domain shown below is 2.2e-16.

GARAALNEIESRHRELLRLEGRIRDVHELFLQMAVLVEKQEDTLNVIELNVQKTLDYTGE
AKAQVRKA

t_SNARE

Helical region found in SNAREs
t_SNARE
SMART accession number:SM00397
Description: All alpha-helical motifs that form twisted and parallel four-helix bundles in target soluble N-ethylmaleimide-sensitive factor (NSF) attachment protein (SNAP) receptor proteins. This motif found in "Q-SNAREs".
Interpro abstract (IPR000727):

The process of vesicular fusion with target membranes depends on a set of SNAREs (SNAP-Receptors), which are associated with the fusing membranes [(PUBMED:9239749), (PUBMED:9232812)]. Target SNAREs (t-SNAREs) are localised on the target membrane and belong to two different families, the syntaxin-like family and the SNAP-25 like family. One member of each family, together with a v-SNARE localised on the vesicular membrane, are required for fusion.

The N- and C-terminal coiled-coil domains of members of the SNAP-25 family and the most C-terminal coiled-coil domain of the syntaxin family are related to each other and form a new homology domain of approximately 60 amino acids. This domain is also found in other known proteins involved in vesicular membrane traffic, some of which belong to different protein families [(PUBMED:9096343)].

Family alignment:
View or

There are 21255 t_SNARE domains in 18689 proteins in SMART's nrdb database.

Click on the following links for more information.