The domain within your query sequence starts at position 195 and ends at position 280; the E-value for the zf-3CxxC domain shown below is 3.38e-23.
LKYGYFHCKDCKRRWESAYVWCISGTNKVYFKQLCNKCQKSFNPYRVEEIQCQTCLRVCC SCSPKKRHIDVRRPHRQELCGHCKDK
zf-3CxxCZinc-binding domain |
---|
SMART accession number: | SM01328 |
---|---|
Description: | This is a family with several pairs of CxxC motifs possibly representing a multiple zinc-binding region. Only one pair of cysteines is associated with a highly conserved histidine residue. |
Interpro abstract (IPR027377): | This is a domain with several pairs of CxxC motifs, possibly representing a multiple zinc-binding region. Only one pair of cysteines is associated with a highly conserved histidine residue. |
Family alignment: |
There are 2480 zf-3CxxC domains in 2474 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)