The coiled coil region chosen starts at position 119 of the query sequence and ends at position 223.

The sequence is:

ALQKLHQDVWKARQARDDLRDQVQKLVQRLTDTEAQKSQVHSELQDLQRQLSQSQEAPVA
IVEGGVGRNSFEKSKWEGRQNSLESELRDLHETAASLQSRLRQAE