The coiled coil region chosen starts at position 242 of the query sequence and ends at position 282.

The sequence is:

FTKLEEENLSLIQNTQEMEETLDELNVTLKNTQIRMDKEVN