The coiled coil region chosen starts at position 398 of the query sequence and ends at position 434.

The sequence is:

AYEEQSQATIAEIEAKEKKFKEALEVLQKEQEVLAAL