The region of low compositional complexity chosen starts at position 140 of the query sequence and ends at position 192.

The sequence is:

QQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQQ