The signal peptide starts at position 1 of the query sequence and ends at position 37.

The sequence is:

MRGARGAWDLLCVLLVLLRGQTATSQPSASPGEPSPP