The domain within your query sequence starts at position 465 and ends at position 613; the E-value for the A2M_N_2 domain shown below is 2.04e-31.

VHLESLPYKLRCEQTLAVQAHYILNDEAVLERKELVFYYLMMAKGGIVRAGTHVLPVTQG
HKKGHFSILISMETDLAPVARLVLYTILPNGEVVGDTVKYEIEKCLANKVDLVFHPNIGL
PATRAFLSVMASPQSLCGLRAVDQSVLLT

A2M_N_2

Alpha-2-Macroglobulin
A2M_N_2
SMART accession number:SM01359
Description: This family includes a region of the alpha-2-macroglobulin family.
Interpro abstract (IPR011625):

Alpha-2-macroglobulins (A2Ms) are plasma proteins that trap and inhibit a broad range of proteases and are major components of the eukaryotic innate immune system. However, A2M-like proteins were identified in pathogenically invasive bacteria and species that colonize higher eukaryotes. In human A2Ms, this domain encompasses macroglobulin-like domain MG5 and 6 including bait region. In Salmonella enterica ser A2Ms, this domain encompasses MG7 and MG8 including the bait region [ (PUBMED:25221932) (PUBMED:22290936) ]. The Bait region is cleaved by proteases, followed by a large conformational change that blocks the target protease within a cage-like complex. This model of protease entrapment is recognised as the Venus flytrap mechanism [ (PUBMED:25221932) ].

Family alignment:
View or

There are 13783 A2M_N_2 domains in 13732 proteins in SMART's nrdb database.

Click on the following links for more information.