The domain within your query sequence starts at position 208 and ends at position 388; the E-value for the ALBUMIN domain shown below is 1.51e-51.

HLSLLTTMSNRVCSQYAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCCE
STSEDCMASELPEHTIKICQNLSKKNSKFEECCQENTPMNIFMCTYFMPAAEPLQLPAIK
LPTGKDLCGQSTTQAMDQYTFELSRRTQVPEVFLSKVLEPTLKTLRECCDTQDSVACFST
Q

ALBUMIN

serum albumin
ALBUMIN
SMART accession number:SM00103
Description: -
Interpro abstract (IPR014760):

A number of serum transport proteins are known to be evolutionarily related, including albumin, alpha-fetoprotein, vitamin D-binding protein and afamin [ (PUBMED:2481749) (PUBMED:2423133) (PUBMED:7517938) ]. Albumin is the main protein of plasma; it binds water, cations (such as Ca 2+ Na + and K + ), fatty acids, hormones, bilirubin and drugs - its main function is to regulate the colloidal osmotic pressure of blood. Alphafeto- protein (alpha-fetoglobulin) is a foetal plasma protein that binds various cations, fatty acids and bilirubin. Vitamin D-binding protein binds to vitamin D and its metabolites, as well as to fatty acids. The biological role of afamin (alpha-albumin) has not yet been characterised. The 3D structure of human serum albumin has been determined by X-ray crystallography to a resolution of 2.8A [ (PUBMED:1630489) ]. It comprises three homologous domains that assemble to form a heart-shaped molecule [ (PUBMED:1630489) ]. Each domain is a product of two subdomains that possess common structural motifs [ (PUBMED:1630489) ]. The principal regions of ligand binding to human serum albumin are located in hydrophobic cavities in subdomains IIA and IIIA, which exhibit similar chemistry. Structurally, the serum albumins are similar, each domain containing five or six internal disulphide bonds, as shown schematically below:


+---+ +----+ +-----+
| | | | | |
xxCxxxxxxxxxxxxxxxxCCxxCxxxxCxxxxxCCxxxCxxxxxxxxxCxxxxxxxxxxxxxxCCxxxxCxxxx
| | | | | |
+-----------------+ +-----+ +---------------+

GO component:extracellular space (GO:0005615)
Family alignment:
View or

There are 2862 ALBUMIN domains in 1132 proteins in SMART's nrdb database.

Click on the following links for more information.