The domain within your query sequence starts at position 67 and ends at position 203; the E-value for the AMP_N domain shown below is 6.87e-50.

LSQVEYALRRHKLMALVHKEAQGHSGTDHTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCG
FQEPDSILVLQSFSGKQLPSHKAMLFVPRRDPGRELWDGPRSGTDGAIALTGVDEAYPLE
EFQHLLPKLRGFHRDHV

AMP_N

Aminopeptidase P, N-terminal domain
AMP_N
SMART accession number:SM01011
Description: This domain is structurally very similar to the creatinase N-terminal domain. However, little or no sequence similarity exists between the two families.
Interpro abstract (IPR007865):

This entry represents the N-terminal domain of aminopeptidase P (X-Pro aminopeptidase I,II and III EC 3.4.11.9 ) and related sequences belonging to the peptidase M24B family. The domain is structurally very similar [ (PUBMED:9520390) ] to the creatinase N-terminal domain ( IPR000587 ).

GO function:metalloaminopeptidase activity (GO:0070006), manganese ion binding (GO:0030145)
Family alignment:
View or

There are 15332 AMP_N domains in 15331 proteins in SMART's nrdb database.

Click on the following links for more information.