The domain within your query sequence starts at position 772 and ends at position 832; the E-value for the APC2 domain shown below is 3.67e-27.

YIQAMLTNLESLSLERIYSMLRMFVMTGPALAEIDLQELQGYLQKKVRDQQLIYSAGVYR
L

APC2

Anaphase promoting complex (APC) subunit 2
APC2
SMART accession number:SM01013
Description: The anaphase promoting complex or cyclosome (APC2) is an E3 ubiquitin ligase which is part of the SCF family of ubiquitin ligases. Ubiquitin ligases catalyse the transfer of ubiquitin from the ubiquitin conjugating enzyme (E2), to the substrate protein.
Interpro abstract (IPR014786):

The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis, such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome.

This entry represents a domain found in the C terminus of APC subunit 2.

Family alignment:
View or

There are 1082 APC2 domains in 1081 proteins in SMART's nrdb database.

Click on the following links for more information.