The domain within your query sequence starts at position 437 and ends at position 535; the E-value for the ASCH domain shown below is 3.19e-4.

LSMHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKDV
EFPNDYPSGCLLGCVDLIDCLSQKQFQEQGNWIPRSIKE

ASCH

ASCH
SMART accession number:SM01022
Description: The ASCH domain adopts a beta-barrel fold similar to that of the PUA domain. It is thought to function as an RNA-binding domain during coactivation, RNA-processing and possibly during prokaryotic translation regulation (PUBMED:16322048).
Interpro abstract (IPR007374):

The ASCH domain adopts a beta-barrel fold similar to that of the PUA domain ( IPR002478 ). It is thought to function as an RNA-binding domain during coactivation, RNA-processing and possibly during prokaryotic translation regulation [ (PUBMED:16322048) ].

Family alignment:
View or

There are 10302 ASCH domains in 10301 proteins in SMART's nrdb database.

Click on the following links for more information.