The domain within your query sequence starts at position 124 and ends at position 504; the E-value for the Aamy domain shown below is 6.7e-110.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 97428212 ) for details.

Catalytic residues
PositionAmino acidPresent?
DomainProtein
219342DNo
N/AN/ADNo
QIYPRSFKDSDKDGNGDLKGIQEKLDYITALNIKTLWITSFYKSSLKDFRYAVEDFKEID
PIFGTMKDFENLVAAIHDKGLKLIIDFIPNHTSDKHPWFQSSRTRSGKYTDYYIWHNCTH
VNGVTTPPNNWLSVYGNSSWHFDEVRKQCYFHQFLKEQPDLNFRNPAVQEEIKEIITFWL
SKGVDGFSFDAVKFLLEAKDLRNEIQVNTSQIPDTVTHYSELYHDFTTTQVGMHDIVRDF
RQTMNQYSREPGRYRFMGAEASAESIERTMMYYGLPFIQEADFPFNKYFTTIGTLSGHTV
YEVITSWMENMPEGKWPNWMTGGPETPRLTSRVGSEYVNAMHMLLFTLPGTPITYYGEEI
GMGDISVTNFNESYDSTTLVS

Aamy

Alpha-amylase domain
Aamy
SMART accession number:SM00642
Description: -
Interpro abstract (IPR006047):

O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website.

Enzymes containing this domain, such as alpha-amylase, belong to family 13 of the glycosyl hydrolases. The maltogenic alpha-amylase is an enzyme which catalyses hydrolysis of (1-4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive alpha-maltose residues from the non-reducing ends of the chains in the conversion of starch to maltose. Other enzymes include neopullulanase, which hydrolyses pullulan to panose, and cyclomaltodextrinase, which hydrolyses cyclodextrins.

This entry represents the catalytic domain found in several protein members of this family. It has a structure consisting of an 8 stranded alpha/beta barrel that contains the active site, interrupted by a ~70 amino acid calcium-binding domain protruding between beta strand 3 and alpha helix 3, and a carboxyl-terminal Greek key beta-barrel domain [ (PUBMED:16302977) ].

GO process:carbohydrate metabolic process (GO:0005975)
GO function:catalytic activity (GO:0003824)
Family alignment:
View or

There are 50832 Aamy domains in 50552 proteins in SMART's nrdb database.

Click on the following links for more information.