The domain within your query sequence starts at position 371 and ends at position 532; the E-value for the AdoHcyase_NAD domain shown below is 2.21e-103.

NLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICAL
QACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVAS
LRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTV

AdoHcyase_NAD

S-adenosyl-L-homocysteine hydrolase, NAD binding domain
AdoHcyase_NAD
SMART accession number:SM00997
Description: -
Interpro abstract (IPR015878):

S-adenosyl-L-homocysteine hydrolase ( EC 3.3.1.1 ) (AdoHcyase) is an enzyme of the activated methyl cycle, responsible for the reversible hydration of S-adenosyl-L-homocysteine into adenosine and homocysteine. AdoHcyase is an ubiquitous enzyme which binds and requires NAD + as a cofactor. AdoHcyase is a highly conserved protein [ (PUBMED:1631127) ] of about 430 to 470 amino acids.

This entry represents the glycine-rich region in the central part of AdoHcyase, which is thought to be involved in NAD-binding [ (PUBMED:1631127) ].

Family alignment:
View or

There are 17321 AdoHcyase_NAD domains in 17318 proteins in SMART's nrdb database.

Click on the following links for more information.