The domain within your query sequence starts at position 544 and ends at position 656; the E-value for the B2-adapt-app_C domain shown below is 3.75e-42.

LVPNLQLTAEYFEKTWLSLRVSYQQVFPWQGEVQPDTLQMALKVVNIQTIAMSRAGAQPW
KAYLSAQDDTGGLFLAELLLKPENSEMQISVKQSKARTESLHGFVSVLETVIG

B2-adapt-app_C

Beta2-adaptin appendage, C-terminal sub-domain
B2-adapt-app_C
SMART accession number:SM01020
Description: Members of this family adopt a structure consisting of a 5 stranded beta-sheet, flanked by one alpha helix on the outer side, and by two alpha helices on the inner side. This domain is required for binding to clathrin, and its subsequent polymerisation. Furthermore, a hydrophobic patch present in the domain also binds to a subset of D-phi-F/W motif-containing proteins that are bound by the alpha-adaptin appendage domain (epsin, AP180, eps15).
Interpro abstract (IPR015151):

This entry represents a subdomain of the appendage (ear) domain of beta-adaptin. This domain has a three-layer arrangement, alpha-beta-alpha, with a bifurcated antiparallel beta-sheet [ (PUBMED:10430869) ]. This domain is required for binding to clathrin, and its subsequent polymerisation. Furthermore, a hydrophobic patch present in the domain also binds to a subset of D-phi-F/W motif-containing proteins that are bound by the alpha-adaptin appendage domain (epsin, AP180, eps15) [ (PUBMED:10944104) ].

GO process:intracellular protein transport (GO:0006886), vesicle-mediated transport (GO:0016192)
GO component:clathrin adaptor complex (GO:0030131)
Family alignment:
View or

There are 1780 B2-adapt-app_C domains in 1780 proteins in SMART's nrdb database.

Click on the following links for more information.