The domain within your query sequence starts at position 744 and ends at position 818; the E-value for the BHD_3 domain shown below is 4.83e-45.

VPRNEFGNVYLFLPSMMPVGCVQMTLPNLNRVARKLGIDCVQAITGFDFHGGYCHPVTDG
YIVCEEFRDVLLAAW

BHD_3

Rad4 beta-hairpin domain 3
BHD_3
SMART accession number:SM01032
Description: This short domain is found in the Rad4 protein. This domain binds to DNA.
Interpro abstract (IPR018328):

This short domain is found in the Rad4 protein. This domain binds to DNA [ (PUBMED:17882165) ].

GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 2161 BHD_3 domains in 2155 proteins in SMART's nrdb database.

Click on the following links for more information.