The domain within your query sequence starts at position 439 and ends at position 517; the E-value for the BING4CT domain shown below is 8.85e-53.

PYLTHRLSGHVHGLQFCPFEDVLGVGHSGGFTSMLVPGAAEPNFDGLENNPYRSRKQRQE
WEVKALLEKVPAELICLNP

BING4CT

BING4CT (NUC141) domain
BING4CT
SMART accession number:SM01033
Description: This C terminal domain is found in the BING4 family of nucleolar WD40 repeat proteins.
Interpro abstract (IPR012952):

This C-terminal domain is found in the BING4 family of nucleolar WD40 repeat proteins [ (PUBMED:15112237) ].

Family alignment:
View or

There are 1501 BING4CT domains in 1499 proteins in SMART's nrdb database.

Click on the following links for more information.