The domain within your query sequence starts at position 2631 and ends at position 2675; the E-value for the BRK domain shown below is 3.77e-23.

TGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWT

BRK

domain in transcription and CHROMO domain helicases
BRK
SMART accession number:SM00592
Description: -
Interpro abstract (IPR006576):

The function of this domain is unknown [ (PUBMED:11779830) ]. It is often found associated with helicases and transcription factors.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 3509 BRK domains in 2609 proteins in SMART's nrdb database.

Click on the following links for more information.