The domain within your query sequence starts at position 2631 and ends at position 2675; the E-value for the BRK domain shown below is 3.77e-23.

TGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWT

BRK

domain in transcription and CHROMO domain helicases

• SMART accession number: SM00592
• Description: -
• Interpro abstract (IPR006576):

  The function of this domain is unknown [ (PUBMED:11779830) ]. It is often found associated with helicases and transcription factors.

• GO function: protein binding (GO:0005515)

There are 3509 BRK domains in 2609 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Doerks T, Copley RR, Schultz J, Ponting CP, Bork P
• Systematic identification of novel protein domain families associated with nuclear functions.
• Genome Res. 2002; 12: 47-56

A systematic computational analysis of protein sequences containing known nuclear domains led to the identification of 28 novel domain families. This represents a 26% increase in the starting set of 107 known nuclear domain families used for the analysis. Most of the novel domains are present in all major eukaryotic lineages, but 3 are species specific. For about 500 of the 1200 proteins that contain these new domains, nuclear localization could be inferred, and for 700, additional features could be predicted. For example, we identified a new domain, likely to have a role downstream of the unfolded protein response; a nematode-specific signalling domain; and a widespread domain, likely to be a noncatalytic homolog of ubiquitin-conjugating enzymes.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
60.00	map04310	Wnt signaling pathway
20.00	map00230	Purine metabolism
10.00	map00500	Starch and sucrose metabolism
10.00	map00790	Folate biosynthesis

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with BRK domain which could be assigned to a KEGG orthologous group, and not all proteins containing BRK domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of BRK domains in PDB

PDB code	Title
2cka	Solution structures of the BRK domains of the human Chromo Helicase Domain 7 and 8, reveals structural similarity with GYF domain suggesting a role in protein interaction
2ckc	Solution structures of the BRK domains of the human Chromo Helicase Domain 7 and 8, reveals structural similarity with GYF domain suggesting a role in protein interaction
2dl6	Solution structure of the first BRK domain from human chromodomain-helicase-DNA-binding protein 8
2v0e	BRK domain from human CHD7
2v0f	BRK domain from human CHD7

Links (links to other resources describing this domain)

• INTERPRO: IPR006576