The domain within your query sequence starts at position 531 and ends at position 642; the E-value for the BROMO domain shown below is 6.07e-39.

KNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNI
RNDKYAGEEGMMEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKDKRKELGP

BROMO

bromo domain
BROMO
SMART accession number:SM00297
Description: -
Interpro abstract (IPR001487):

Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [ (PUBMED:1350857) ]. Bromodomains can interact with acetylated lysine [ (PUBMED:9175470) ]. In some proteins, the classical bromodomain has diverged to such an extent that parts of the region are either missing or contain an insertion (e.g., mammalian protein HRX, Caenorhabditis elegans hypothetical protein ZK783.4, yeast protein YTA7). The bromodomain may occur as a single copy, or in duplicate.

The precise function of the domain is unclear, but it may be involved in protein-protein interactions and may play a role in assembly or activity of multi-component complexes involved in transcriptional activation [ (PUBMED:7580139) ].

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 52668 BROMO domains in 38864 proteins in SMART's nrdb database.

Click on the following links for more information.