The domain within your query sequence starts at position 531 and ends at position 642; the E-value for the BROMO domain shown below is 6.07e-39.
KNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNI RNDKYAGEEGMMEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKDKRKELGP
BROMObromo domain |
|---|
| SMART accession number: | SM00297 |
|---|---|
| Description: | - |
| Interpro abstract (IPR001487): | Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [ (PUBMED:1350857) ]. Bromodomains can interact with acetylated lysine [ (PUBMED:9175470) ]. In some proteins, the classical bromodomain has diverged to such an extent that parts of the region are either missing or contain an insertion (e.g., mammalian protein HRX, Caenorhabditis elegans hypothetical protein ZK783.4, yeast protein YTA7). The bromodomain may occur as a single copy, or in duplicate. The precise function of the domain is unclear, but it may be involved in protein-protein interactions and may play a role in assembly or activity of multi-component complexes involved in transcriptional activation [ (PUBMED:7580139) ]. |
| GO function: | protein binding (GO:0005515) |
| Family alignment: |
There are 52668 BROMO domains in 38864 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing BROMO domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with BROMO domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing BROMO domain in the selected taxonomic class.
- Literature (relevant references for this domain)
-
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
- Kouzarides T
- Acetylation: a regulatory modification to rival phosphorylation?
- EMBO J. 2000; 19: 1176-9
- Display abstract
The fact that histones are modified by acetylation has been known for almost 30 years. The recent identification of enzymes that regulate histone acetylation has revealed a broader use of this modification than was suspected previously. Acetylases are now known to modify a variety of proteins, including transcription factors, nuclear import factors and alpha-tubulin. Acetylation regulates many diverse functions, including DNA recognition, protein-protein interaction and protein stability. There is even a conserved structure, the bromodomain, that recognizes acetylated residues and may serve as a signalling domain. If you think all this sounds familiar, it should be. These are features characteristic of kinases. So, is acetylation a modification analogous to phosphorylation? This review sets out what we know about the broader substrate specificity and regulation of acetyl- ases and goes on to compare acetylation with the process of phosphorylation.
- Dhalluin C, Carlson JE, Zeng L, He C, Aggarwal AK, Zhou MM
- Structure and ligand of a histone acetyltransferase bromodomain.
- Nature. 1999; 399: 491-6
- Display abstract
Histone acetylation is important in chromatin remodelling and gene activation. Nearly all known histone-acetyltransferase (HAT)-associated transcriptional co-activators contain bromodomains, which are approximately 110-amino-acid modules found in many chromatin-associated proteins. Despite the wide occurrence of these bromodomains, their three-dimensional structure and binding partners remain unknown. Here we report the solution structure of the bromodomain of the HAT co-activator P/CAF (p300/CBP-associated factor). The structure reveals an unusual left-handed up-and-down four-helix bundle. In addition, we show by a combination of structural and site-directed mutagenesis studies that bromodomains can interact specifically with acetylated lysine, making them the first known protein modules to do so. The nature of the recognition of acetyl-lysine by the P/CAF bromodomain is similar to that of acetyl-CoA by histone acetyltransferase. Thus, the bromodomain is functionally linked to the HAT activity of co-activators in the regulation of gene transcription.
- Metabolism (metabolic pathways involving proteins which contain this domain)
-
Click the image to view the interactive version of the map in iPath% proteins involved KEGG pathway ID Description 17.99 map04330 Notch signaling pathway 7.41 map03022 Basal transcription factors 6.88 map04520 Adherens junction 6.88 map04630 Jak-STAT signaling pathway 6.88 map05215 Prostate cancer 6.88 map04310 Wnt signaling pathway 6.88 map04350 TGF-beta signaling pathway 6.88 map05211 Renal cell carcinoma 6.88 map04110 Cell cycle 6.88 map05040 Huntington's disease 6.88 map04720 Long-term potentiation 6.88 map04916 Melanogenesis 2.65 map04530 Tight junction 1.59 
map00230Purine metabolism 0.53 map00190Oxidative phosphorylation 0.53 map00790Folate biosynthesis 0.53 map00500Starch and sucrose metabolism This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with BROMO domain which could be assigned to a KEGG orthologous group, and not all proteins containing BROMO domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of BROMO domains in PDB
PDB code Main view Title 1e6i 
Bromodomain from GCN5 complexed with acetylated H4 peptide 1eqf 
CRYSTAL STRUCTURE OF THE DOUBLE BROMODOMAIN MODULE FROM HUMAN TAFII250 1f68 
NMR SOLUTION STRUCTURE OF THE BROMODOMAIN FROM HUMAN GCN5 1jm4 
NMR Structure of P/CAF Bromodomain in Complex with HIV-1 Tat Peptide 1jsp 
NMR Structure of CBP Bromodomain in complex with p53 peptide 1n72 
Structure and Ligand of a Histone Acetyltransferase Bromodomain 1wug 
complex structure of PCAF bromodomain with small chemical ligand NP1 1wum 
Complex structure of PCAF bromodomain with small chemical ligand NP2 1x0j 
Crystal structure analysis of the N-terminal bromodomain of human Brd2 1zs5 
Structure-based evaluation of selective and non-selective small molecules that block HIV-1 TAT and PCAF association 2d82 
Target Structure-Based Discovery of Small Molecules that Block Human p53 and CREB Binding Protein (CBP) Association 2d9e 
Solution structure of the Bromodomain of Peregrin 2dat 
Solution structure of the Bromodomain of human SWI/SNF related matrix associated actin dependent regulator of cromatin subfamily A member 2 2dkw 
Solution structure of the bromodomain of human protein KIAA1240 2dvq 
Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide 2dvr 
Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide 2dvs 
Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide 2dvv 
Crystal structure of the second bromodomain of the human Brd2 protein 2dww 
Crystal structure of Bromodomain-containing protein 4 2e3k 
Crystal structure of the human Brd2 second bromodomain in complexed with the acetylated histone H4 peptide 2e7n 
Solution structure of the second Bromodomain from human Bromodomain-containing protein 3 2e7o 
Solution structure of the Bromodomain from human Bromodomain adjacent to zinc finger domain 2B 2f6j 
Crystal structure of PHD finger-linker-bromodomain fragment of human BPTF in the H3(1-15)K4me3 bound state 2f6n 
Crystal structure of PHD finger-linker-bromodomain fragment of human BPTF in the free form 2fsa 
Crystal structure of PHD finger-linker-bromodomain fragment of human BPTF in the H3(1-15)K4ME2 bound state 2g4a 
Solution structure of a Bromodomain from RING3 protein 2grc 
1.5 A structure of bromodomain from human BRG1 protein, a central ATPase of SWI/SNF remodeling complex 2h60 
Solution Structure of Human Brg1 Bromodomain 2i7k 
Solution Structure of the Bromodomain of Human BRD7 Protein 2i8n 
Solution structure of the second bromodomain of Brd4 2ktb 
Solution Structure of the Second Bromodomain of Human Polybromo in complex with an acetylated peptide from Histone 3 2l5e 
Complex between BD1 of Brd3 and GATA-1 C-tail 2l84 
Solution NMR structures of CBP bromodomain with small molecule j28 2l85 
Solution NMR structures of CBP bromodomain with small molecule of HBS 2lsp 
solution structures of BRD4 second bromodomain with NF-kB-K310ac peptide 2mjv 
Solution structures of second bromodomain of Brd4 with di-acetylated Twist peptide 2n9g 
2N9G 2nxb 
Crystal structure of human Bromodomain containing protein 3 (BRD3) 2oo1 
Crystal structure of the Bromo domain 2 of human Bromodomain containing protein 3 (BRD3) 2oss 
Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 (BRD4) 2ouo 
Crystal Structure of the Bromo domain 2 in human Bromodomain Containing Protein 4 (BRD4) 2r0s 
Crystal Structure of the Rsc4 tandem bromodomain 2r0v 
Structure of the Rsc4 tandem bromodomain acetylated at K25 2r0y 
Structure of the Rsc4 tandem bromodomain in complex with an acetylated H3 peptide 2r10 
Structure of an acetylated Rsc4 tandem bromodomain Histone Chimera 2rfj 
Crystal structure of the bromo domain 1 in human bromodomain containing protein, testis specific (BRDT) 2ri7 
Crystal structure of PHD finger-linker-bromodomain Y17E mutant from human BPTF in the H3(1-9)K4ME2 bound state 2rnw 
The Structural Basis for Site-Specific Lysine-Acetylated Histone Recognition by the Bromodomains of the Human Transcriptional Co-Activators PCAf and CBP 2rnx 
The Structural Basis for Site-Specific Lysine-Acetylated Histone Recognition by the Bromodomains of the HUman Transcriptional Co-Activators PCAF and CBP 2rny 
Complex Structures of CBP Bromodomain with H4 ack20 Peptide 2ro1 
NMR Solution Structures of Human KAP1 PHD finger-bromodomain 2rs9 
Solution structure of the bromodomain of human BRPF1 in complex with histone H4K5ac peptide 2wp1 
Structure of Brdt bromodomain 2 bound to an acetylated histone H3 peptide 2wp2 
Structure of Brdt bromodomain BD1 bound to a diacetylated histone H4 peptide. 2ydw 
Crystal Structure of the First Bromodomain of Human Brd2 with the inhibitor GW841819X 2yek 
Crystal Structure of the First Bromodomain of Human Brd2 with the inhibitor GSK525762 (IBET) 2yel 
Crystal Structure of the First Bromodomain of Human Brd4 with the inhibitor GW841819X 2yem 
Crystal Structure of the Second Bromodomain of Human Brd4 with the inhibitor GW841819X 2yqd 
Solution structure of the fifth bromodomain from mouse polybromo-1 2yw5 
Solution structure of the bromodomain from human bromodomain containing protein 3 2yyn 
Crystal sturcture of human bromodomain protein 3aad 
Structure of the histone chaperone CIA/ASF1-double bromodomain complex linking histone modifications and site-specific histone eviction 3aqa 
Crystal structure of the human BRD2 BD1 bromodomain in complex with a BRD2-interactive compound, BIC1 3d7c 
Crystal structure of the bromodomain of human GCN5, the general control of amino-acid synthesis protein 5-like 2 3dai 
Crystal structure of the bromodomain of the human ATAD2 3dwy 
Crystal Structure of the Bromodomain of Human CREBBP 3fkm 
Plasmodium falciparum bromodomain-containing protein PF10_0328 3g0j 
Crystal Structure of the fifth Bromodomain of Human Poly-bromodomain containing protein 1 (PB1) 3g0l 
Crystal Structure of Human Bromodomain Adjacent to Zinc finger domain 2B (BAZ2B) 3gg3 
Crystal Structure of the Bromodomain of Human PCAF 3hme 
Crystal structure of human bromodomain containing 9 isoform 1 (BRD9) 3hmf 
Crystal Structure of the second Bromodomain of Human Poly-bromodomain containing protein 1 (PB1) 3hmh 
Crystal structure of the second bromodomain of human TBP-associated factor RNA polymerase 1-like (TAF1L) 3i3j 
Crystal Structure of the Bromodomain of Human EP300 3iu5 
Crystal structure of the first bromodomain of human poly-bromodomain containing protein 1 (PB1) 3iu6 
Crystal structure of the sixth bromodomain of human poly-bromodomain containing protein 1 (PB1) 3jvj 
Crystal structure of the bromodomain 1 in mouse Brd4 3jvk 
Crystal structure of bromodomain 1 of mouse Brd4 in complex with histone H3-K(ac)14 3jvl 
Crystal structure of bromodomain 2 of mouse Brd4 3jvm 
Crystal structure of bromodomain 2 of mouse Brd4 3k2j 
Crystal Structure of the 3rd Bromodomain of Human Poly-bromodomain containing protein 1 (PB1) 3ljw 
Crystal Structure of the Second Bromodomain of Human Polybromo 3lqh 
Crystal structure of MLL1 PHD3-Bromo in the free form 3lqi 
Crystal structure of MLL1 PHD3-Bromo complexed with H3(1-9)K4me2 peptide 3lqj 
Crystal structure of MLL1 PHD3-Bromo complexed with H3(1-9)K4me3 peptide 3lxj 
Crystal Structure of the Bromodomain of Human AAA domain containing 2B (ATAD2B) 3mb3 
Crystal Structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP) 3mb4 
Crystal Structure of the fifth Bromodomain of Human Poly-bromodomain containing protein 1 (PB1) with NMP 3mqm 
Crystal Structure of the Bromodomain of human ASH1L 3muk 
Crystal structure of Brd4 bromodomain 1 with propionylated histone H3-K(prop)23 3mul 
Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14 3mxf 
Crystal Structure of the first bromodomain of human BRD4 in complex with the inhibitor JQ1 3nxb 
Crystal Structure of the Bromodomain of human CECR2 3o33 
Crystal structure of TRIM24 PHD-Bromo in the free state 3o34 
Crystal structure of TRIM24 PHD-Bromo complexed with H3(13-32)K23ac peptide 3o35 
Crystal structure of TRIM24 PHD-Bromo complexed with H3(23-31)K27ac peptide 3o36 
Crystal structure of TRIM24 PHD-Bromo complexed with H4(14-19)K16ac peptide 3o37 
Crystal structure of TRIM24 PHD-Bromo complexed with H3(1-10)K4 peptide 3oni 
Crystal Structure of the second bromodomain of human BRD2 in complex with the inhibitor JQ1 3p1c 
Crystal structure of the bromodomain of human CREBBP in complex with acetylated lysine 3p1d 
Crystal structure of the bromodomain of human CREBBP in complex with N-Methyl-2-pyrrolidone (NMP) 3p1e 
Crystal structure of the bromodomain of human CREBBP in complex with dimethyl sulfoxide (DMSO) 3p1f 
Crystal structure of the bromodomain of human CREBBP in complex with a hydroquinazolin ligand 3p5o 
Crystal Structure of the First Bromodomain of Human Brd4 in complex with IBET inhibitor 3q2e 
Crystal structure of the second bromodomain of human bromodomain and WD repeat-containing protein 1 isoform A (WDR9) 3q2f 
Crystal Structure of the bromodomain of human BAZ2B in complex with a triazolo ligand 3qzs 
Crystal Structure of BPTF bromo in complex with histone H4K16ac - Form I 3qzt 
Crystal Structure of BPTF bromo in complex with histone H4K16ac - Form II 3qzv 
Crystal Structure of BPTF PHD-linker-bromo in complex with histone H4K12ac peptide 3rcw 
Crystal Structure of the bromodomain of human BRD1 3s91 
Crystal Structure of the first bromodomain of human BRD3 in complex with the inhibitor JQ1 3s92 
Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor JQ1 3svf 
Crystal Structure of the first bromodomain of human BRD4 in complex with a dihydro-quinazolin ligand 3svg 
Crystal Structure of the first bromodomain of human BRD4 in complex with a 3,5-dimethylisoxazol ligand 3svh 
Crystal Structure of the bromdomain of human CREBBP in complex with a 3,5-dimethylisoxazol ligand 3tlp 
Crystal structure of the fourth bromodomain of human poly-bromodomain containing protein 1 (PB1) 3u5j 
Crystal Structure of the first bromodomain of human BRD4 in complex with Alprazolam 3u5k 
Crystal Structure of the first bromodomain of human BRD4 in complex with Midazolam 3u5l 
Crystal Structure of the first bromodomain of human BRD4 in complex with a benzo-triazepine ligand (BzT-7) 3u5m 
Crystal structure of TRIM33 PHD-Bromo in the free state 3u5n 
Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-20)K9me3K14ac histone peptide 3u5o 
Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-22)K9me3K14acK18ac histone peptide 3u5p 
Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-28)K9me3K14acK18acK23ac histone peptide 3uv2 
Crystal structure of the bromodomain of human nucleosome-remodeling factor subunit BPTF 3uv4 
Crystal Structure of the second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1) 3uv5 
Crystal Structure of the tandem bromodomains of human Transcription initiation factor TFIID subunit 1 (TAF1) 3uvd 
Crystal Structure of the bromodomain of human Transcription activator BRG1 (SMARCA4) in complex with N-Methyl-2-pyrrolidone 3uvw 
Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K5acK8ac) 3uvx 
Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K12acK16ac) 3uvy 
Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K16acK20ac) 3uw9 
Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K8acK12ac) 3zyu 
Crystal Structure of the first bromodomain of human BRD4 in complex with I-BET151(GSK1210151A) 4a9e 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3-methyl-1,2,3,4- tetrahydroquinazolin-2-one 4a9f 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 1-METHYLPYRROLIDIN-2-ONE 4a9h 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 1-(2-methyl-1,2,3,4-tetrahydroquinolin-1-yl)ethan-1-one 4a9i 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3-methyl-1,2,3,4- tetrahydroquinazolin-2-one 4a9j 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N-(4-hydroxyphenyl) acetamide 4a9k 
BROMODOMAIN OF HUMAN CREBBP WITH N-(4-hydroxyphenyl)acetamide 4a9l 
N-TERMINAL BROMODOMAIN OF HUMAN BRD4 WITH 1,3-DIMETHYL-6-(MORPHOLINE- 4-SULFONYL)-1,2,3,4-TETRAHYDROQUINAZOLIN-2-ONE 4a9m 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N-cyclopentyl-5-(3,5- dimethyl-1,2-oxazol-4-yl)-2-methylbenzene-1-sulfonamide 4a9n 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N-cyclopropyl-5-(3,5- dimethyl-1,2-oxazol-4-yl)-2-methylbenzene-1-sulfonamide 4a9o 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 5 ethyl-3-methyl-4-phenyl-1, 2-oxazole 4akn 
N-Terminal Bromodomain of Human BRD2 With tbutyl-phenyl-amino- dimethyl-oxazolyl-quinoline-carboxylic acid 4alg 
N-Terminal Bromodomain of Human BRD2 With IBET-151 4alh 
N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3,5 dimethyl-4-phenyl-1,2- oxazole 4bhw 
Structural basis for autoinhibition of the acetyltransferase activity of p300 4bjx 
N-TERMINAL BROMODOMAIN OF HUMAN BRD4 WITH GSK1324726A (I-BET726) 4bw1 
The first bromodomain of human BRD4 in complex with 3,5 dimethylisoxaxole ligand 4bw2 
The first bromodomain of human BRD4 in complex with 3,5 dimethylisoxaxole ligand 4bw3 
The first bromodomain of human BRD4 in complex with 3,5 dimethylisoxaxole ligand 4bw4 
The first bromodomain of human BRD4 in complex with 3,5 dimethylisoxaxole ligand 4c66 
Discovery of Epigenetic Regulator I-BET762: Lead Optimization to Afford a Clinical Candidate Inhibitor of the BET Bromodomains 4c67 
Discovery of Epigenetic Regulator I-BET762: Lead Optimization to Afford a Clinical Candidate Inhibitor of the BET Bromodomains 4cfk 
N-TERMINAL BROMODOMAIN OF HUMAN BRD4 WITH LY294002 4cfl 
N-TERMINAL BROMODOMAIN OF HUMAN BRD4 WITH LY303511 4cl9 
4CL9 4clb 
4CLB 4cos 
Crystal structure of the PHD-Bromo-PWWP cassette of human PRKCBP1 4cup 
Crystal structure of human BAZ2B in complex with fragment-1 N09421 4cuq 
Crystal structure of human BAZ2B in complex with fragment-2 N09594 4cur 
Crystal structure of human BAZ2B in complex with fragment-3 N09555 4cus 
Crystal structure of human BAZ2B in complex with fragment-4 N09496 4cut 
Crystal structure of human BAZ2B in complex with fragment-5 N09428 4cuu 
Crystal structure of human BAZ2B in complex with fragment-6 N09645 4don 
Brd4 Bromodomain 1 complex with a fragment 3,4-Dihydro-3-methyl-2(1H)-quinazolinon 4e96 
Crystal Structure of the first bromodomain of human BRD4 in complex with the inhibitor PFi-1 4f3i 
Crystal structure of the first bromodomain of human BRD4 in complex with MS417 inhibitor 4flp 
Crystal Structure of the first bromodomain of human BRDT in complex with the inhibitor JQ1 4gpj 
Crystal Structure of the first bromodomain of human BRD4 in complex with a isoxazolylbenzimidazole ligand 4hbv 
Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazolin ligand 4hbw 
Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazoline ligand 4hbx 
Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazolin ligand 4hby 
Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazolin ligand 4hxk 
Brd4 Bromodomain 1 complex with 6,7-DIHYDROTHIENO[3,2-C]PYRIDIN-5(4H)-YL(1H-IMIDAZOL-1-YL)METHANONE inhibitor 4hxl 
Brd4 Bromodomain 1 complex with 3-CYCLOHEXYL-N-{3-(2-OXO-2,3-DIHYDRO-1,3-THIAZOL-4-YL)-5-[(THIOPHEN-2-YLSULFONYL)AMINO]PHENYL}PROPANAMIDE inhibitor 4hxm 
Brd4 Bromodomain 1 complex with N-{3-(2-OXO-2,3-DIHYDRO-1,3-THIAZOL-4-YL)-5-[(THIOPHEN-2-YLSULFONYL)AMINO]PHENYL}BUTANAMIDE inhibitor 4hxn 
Brd4 Bromodomain 1 complex with 4-(2-FLUOROPHENYL)-1,3-THIAZOL-2(3H)-ONE inhibitor 4hxo 
Brd4 Bromodomain 1 complex with 3-{[(3-METHYL-1,2-OXAZOL-5-YL)METHYL]SULFANYL}[1,2,4]TRIAZOLO[4,3-A]PYRIDINE inhibitor 4hxp 
Brd4 Bromodomain 1 complex with 4-(2-OXO-1,3-OXAZOLIDIN-3-YL)BENZAMIDE inhibitor 4hxr 
Brd4 Bromodomain 1 complex with N-[3-(2-OXO-2,3-DIHYDRO-1,3-THIAZOL-4-YL)PHENYL]THIOPHENE-2-SULFONAMIDE inhibitor 4hxs 
Brd4 Bromodomain 1 complex with N-[3-(2-OXO-2,3-DIHYDRO-1,3-THIAZOL-4-YL)PHENYL]-1-PHENYLMETHANESULFONAMIDE inhibitor 4ioo 
Crystal Structure of the first bromodomain of BRD4 in complex with N-methyltrimethylacetamide 4ioq 
Crystal Structure of the first bromodomain of BRD4 in complex with pyrrolidin-2-one 4ior 
Crystal Structure of the first bromodomain of BRD4 in complex with DMSO 4ir3 
Crystal Structure of the bromodomain of human BAZ2B in complex with 1-[7-amino-1-(pyrimidin-2-yl)indolizin-3-yl]ethanone (GSK2833282A) 4ir4 
Crystal Structure of the bromodomain of human BAZ2B in complex with 1-[7-(morpholin-4-yl)-1-(pyridin-2-yl)indolizin-3-yl]ethanone (GSK2834113A) 4ir5 
Crystal Structure of the bromodomain of human BAZ2B in complex with 1-{1-[2-(hydroxymethyl)phenyl]-7-phenoxyindolizin-3-yl}ethanone (GSK2847449A) 4ir6 
Crystal Structure of the bromodomain of human BAZ2B in complex with 1-{1-[2-(METHYLSULFONYL)PHENYL]-7-PHENOXYINDOLIZIN-3-YL}ETHANONE (GSK2838097A) 4j0r 
Crystal Structure of the first bromodomain of human BRD4 in complex with a 3,5-dimethylisoxazol ligand 4j0s 
Crystal Structure of the first bromodomain of human BRD4 in complex with a 3,5-dimethylisoxazol ligand 4j1p 
X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A resolution 4j3i 
X-ray crystal structure of bromodomain complex to 1.24 A resolution 4kcx 
BRDT in complex with Dinaciclib 4kv1 
Crystal Structure of Brd4 Bromodomain 1 in Complex with Acetylated Rel Peptide 4kv4 
Brd4 Bromodomain 2 in Complex with Acetylated Rel Peptide 4lc2 
Crystal structure of the bromodomain of human BRPF1B 4ldf 
Crystal Structure of CpBRD2 from cryptosporidium, cgd3_3190 4lr6 
Structure of BRD4 bromodomain 1 with a 3-methyl-4-phenylisoxazol-5-amine fragment 4lrg 
Structure of BRD4 bromodomain 1 with a dimethyl thiophene isoxazole azepine carboxamide 4lyi 
Crystal Structure of apo-BRD4(1) 4lys 
Crystal Structure of BRD4(1) bound to Colchiceine 4lyw 
Crystal Structure of BRD4(1) bound to inhibitor XD14 4lz2 
Crystal structure of the bromodomain of human BAZ2A 4lzr 
Crystal Structure of BRD4(1) bound to Colchicine 4lzs 
Crystal Structure of BRD4(1) bound to inhibitor XD46 4men 
Crystal Structure of the first bromodomain of human BRD4 in complex with a 5-methyl-triazolopyrimidine ligand 4meo 
Crystal Structure of the first bromodomain of human BRD4 in complex with a 2-methyl-quinoline ligand 4mep 
Crystal Structure of the first bromodomain of human BRD4 in complex with a 3-chloro-pyridone ligand 4meq 
Crystal Structure of the first bromodomain of human BRD4 in complex with a 5-methyl-triazolopyrimidine ligand 4mr3 
Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazolinone ligand (RVX-OH) 4mr4 
Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazolinone ligand (RVX-208) 4mr5 
Crystal Structure of the second bromodomain of human BRD2 in complex with a quinazolinone ligand (RVX-OH) 4mr6 
Crystal Structure of the second bromodomain of human BRD2 in complex with a quinazolinone ligand (RVX-208) 4n3w 
Crystal Structure of the Bromodomain-PHD Finger Module of Human Transcriptional Co-Activator CBP in complex with Acetylated Histone 4 Peptide (H4K20ac). 4n4f 
Crystal Structure of the Bromodomain-PHD Finger Module of Human Transcriptional Co-Activator CBP in complex with di-Acetylated Histone 4 Peptide (H412acK16ac). 4n4g 
Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha 4n4h 
Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.1K36me3 4n4i 
Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.3K36me3 4nqm 
Crystal Structure of the first bromodomain of human BRD4 in complex with a triazolo-phthalazine ligand 4nqn 
Crystal Structure of the bromodomain of human BRD9 in complex with a triazolo-phthalazine ligand 4nr4 
Crystal structure of the bromodomain of human CREBBP in complex with an isoxazolyl-benzimidazole ligand 4nr5 
Crystal structure of the bromodomain of human CREBBP in complex with an isoxazolyl-benzimidazole ligand 4nr6 
Crystal structure of the bromodomain of human CREBBP in complex with an oxazepin ligand 4nr7 
Crystal structure of the bromodomain of human CREBBP in complex with an isoxazolyl-benzimidazole ligand 4nr8 
Crystal structure of the first bromodomain of human BRD4 in complex with an isoxazolyl-benzimidazole ligand 4nr9 
Crystal Structure of the bromodomain of human BAZ2B in complex with acetylated lysine 4nra 
Crystal Structure of the bromodomain of human BAZ2B in complex with compound-6 E11322 4nrb 
Crystal Structure of the bromodomain of human BAZ2B in complex with compound-1 N01197 4nrc 
Crystal Structure of the bromodomain of human BAZ2B in complex with compound-3 N01186 4ns5 
Crystal structure of human BS69 Bromo-Zinc finger-PWWP 4nuc 
Crystal structure of the first bromodomain of human BRD4 in complex with MS435 inhibitor 4nud 
Crystal structure of the first bromodomain of human BRD4 in complex with MS436 inhibitor 4nue 
Crystal structure of the first bromodomain of human BRD4 in complex with MS267 inhibitor 4nxj 
Crystal Structure of PF3D7_1475600, a bromodomain from Plasmodium Falciparum 4nyv 
Crystal Structure of the Bromodomain of human CREBBP in complex with a quinazolin-one ligand 4nyw 
Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand 4nyx 
Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand 4o70 
Crystal structure of the first bromodomain of human BRD4 in complex with DINACICLIB 4o71 
Crystal structure of the first bromodomain of human BRD4 in complex with FLAVOPIRIDOL 4o72 
Crystal structure of the first bromodomain of human BRD4 in complex with NU7441 4o74 
Crystal structure of the first bromodomain of human BRD4 in complex with BI 2536 4o75 
Crystal structure of the first bromodomain of human BRD4 in complex with FOSTAMATINIB 4o76 
Crystal structure of the first bromodomain of human BRD4 in complex with TG101209 4o77 
Crystal structure of the first bromodomain of human BRD4 in complex with SB 202190 4o78 
Crystal structure of the first bromodomain of human BRD4 in complex with GW612286X 4o7a 
Crystal structure of the first bromodomain of human BRD4 in complex with SB-409514 4o7b 
Crystal structure of the first bromodomain of human BRD4 in complex with SB-284847-BT 4o7c 
Crystal structure of the first bromodomain of human BRD4 in complex with SB-614067-R 4o7e 
Crystal structure of the first bromodomain of human BRD4 in complex with SB-610251-B 4o7f 
Crystal structure of the first bromodomain of human BRD4 in complex with SB-251527 4ogi 
Crystal Structure of the first bromodomain of human BRD4 in complex with the inhibitor BI-2536 4ogj 
Crystal Structure of the first bromodomain of human BRD4 in complex with the inhibitor TG-101348 4ouf 
Crystal Structure of CBP bromodomain 4pce 
Crystal Structure of the first bromodomain of human BRD4 in complex with compound B13 4pci 
Crystal Structure of the first bromodomain of BRD4 in complex with B16 4pkl 
4PKL 4ps5 
Crystal structure of the first bromodomain of human BRD4 in complex with TG101348 4ptb 
Crystal structure of human SP100 PHD-Bromodomain in the free state 4py6 
Crystal Structure of bromodomain of PFA0510w from Plasmodium Falciparum 4q0n 
Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand 4q0o 
Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand 4qb3 
4QB3 4qbm 
Crystal structure of human BAZ2A bromodomain in complex with a diacetylated histone 4 peptide (H4K16acK20ac) 4qc1 
Crystal structure of human BAZ2B bromodomain in complex with an acetylated histone 3 peptide (H3K14ac) 4qc3 
Crystal structure of human BAZ2B bromodomain in complex with a diacetylated histone 4 peptide (H4K8acK12ac) 4qeu 
4QEU 4qev 
4QEV 4qew 
4QEW 4qns 
4QNS 4qr3 
4QR3 4qr4 
4QR4 4qr5 
4QR5 4qsp 
4QSP 4qsq 
4QSQ 4qsr 
4QSR 4qss 
4QSS 4qst 
4QST 4qsu 
4QSU 4qsv 
4QSV 4qsw 
4QSW 4qsx 
4QSX 4qut 
4QUT 4quu 
4QUU 4qy4 
4QY4 4qyd 
4QYD 4qyl 
4QYL 4qzs 
4QZS 4rvr 
4RVR 4tqn 
4TQN 4ts8 
4TS8 4tt2 
4TT2 4tt4 
4TT4 4tt6 
4TT6 4tte 
4TTE 4tu4 
4TU4 4tu6 
4TU6 4tyl 
4TYL 4tz2 
4TZ2 4tz8 
4TZ8 4uit 
4UIT 4uiu 
4UIU 4uiv 
4UIV 4uiw 
4UIW 4uix 
4UIX 4uiy 
4UIY 4uiz 
4UIZ 4uyd 
4UYD 4uye 
4UYE 4uyf 
4UYF 4uyg 
4UYG 4uyh 
4UYH 4whu 
4WHU 4whw 
4WHW 4wiv 
4WIV 4x2i 
4X2I 4xua 
4XUA 4xub 
4XUB 4xy8 
4XY8 4xy9 
4XY9 4xya 
4XYA 4y03 
4Y03 4yab 
4YAB 4yad 
4YAD 4yat 
4YAT 4yax 
4YAX 4ybm 
4YBM 4ybs 
4YBS 4ybt 
4YBT 4yc9 
4YC9 4yh3 
4YH3 4yh4 
4YH4 4yk0 
4YK0 4yy4 
4YY4 4yy6 
4YY6 4yyd 
4YYD 4yyg 
4YYG 4yyh 
4YYH 4yyi 
4YYI 4yyj 
4YYJ 4yyk 
4YYK 4yym 
4YYM 4yyn 
4YYN 4z1q 
4Z1Q 4z1s 
4Z1S 4z6h 
4Z6H 4z6i 
4Z6I 4z93 
4Z93 4zc9 
4ZC9 4zql 
4ZQL 4zw1 
4ZW1 5a5n 
5A5N 5a5o 
5A5O 5a5p 
5A5P 5a5q 
5A5Q 5a5r 
5A5R 5a5s 
5A5S 5a7c 
5A7C 5a81 
5A81 5a82 
5A82 5a83 
5A83 5a85 
5A85 5acy 
5ACY 5ad2 
5AD2 5ad3 
5AD3 5ame 
5AME 5amf 
5AMF 5b73 
5B73 5bt3 
5BT3 5bt4 
5BT4 5bt5 
5BT5 5c4q 
5C4Q 5c7n 
5C7N 5c85 
5C85 5c87 
5C87 5c89 
5C89 5c8g 
5C8G 5cfw 
5CFW 5cgp 
5CGP 5coi 
5COI 5cp5 
5CP5 5cpe 
5CPE 5cq3 
5CQ3 5cq4 
5CQ4 5cq5 
5CQ5 5cq6 
5CQ6 5cq7 
5CQ7 5cq8 
5CQ8 5cqa 
5CQA 5cqt 
5CQT 5crm 
5CRM 5crz 
5CRZ 5cs8 
5CS8 5ctl 
5CTL 5cu8 
5CU8 5cua 
5CUA 5cub 
5CUB 5cuc 
5CUC 5cud 
5CUD 5cue 
5CUE 5cug 
5CUG 5cy9 
5CY9 5czg 
5CZG 5d0c 
5D0C 5d24 
5D24 5d25 
5D25 5d26 
5D26 5d3h 
5D3H 5d3j 
5D3J 5d3l 
5D3L 5d3n 
5D3N 5d3p 
5D3P 5d3r 
5D3R 5d3s 
5D3S 5d3t 
5D3T 5d7x 
5D7X 5dbm 
5DBM 5dfb 
5DFB 5dfc 
5DFC 5dfd 
5DFD 5dkc 
5DKC 5dkd 
5DKD 5dkh 
5DKH 5dlx 
5DLX 5dlz 
5DLZ 5dw1 
5DW1 5dw2 
5DW2 5dx4 
5DX4 5dy7 
5DY7 5dya 
5DYA 5dyc 
5DYC 5dyu 
5DYU 5dyx 
5DYX 5e0r 
5E0R 5e3d 
5E3D 5e3g 
5E3G 5e73 
5E73 5e74 
5E74 5e7d 
5E7D 5e9i 
5E9I 5e9k 
5E9K 5e9l 
5E9L 5e9m 
5E9M 5e9v 
5E9V 5e9y 
5E9Y 5ea1 
5EA1 5egu 
5EGU 5ei4 
5EI4 5eic 
5EIC 5eis 
5EIS 5ek9 
5EK9 5em3 
5EM3 5enb 
5ENB 5enc 
5ENC 5ene 
5ENE 5enf 
5ENF 5eng 
5ENG 5enh 
5ENH 5eni 
5ENI 5enj 
5ENJ 5ep7 
5EP7 5epb 
5EPB 5epr 
5EPR 5eps 
5EPS 5eq1 
5EQ1 5etb 
5ETB 5etd 
5ETD 5eu1 
5EU1 5ev9 
5EV9 5eva 
5EVA 5ewc 
5EWC 5ewd 
5EWD 5ewh 
5EWH 5ewv 
5EWV 5eww 
5EWW 5f1h 
5F1H 5f1l 
5F1L 5f25 
5F25 5f2p 
5F2P 5fb0 
5FB0 5fb1 
5FB1 5fbx 
5FBX 5fdz 
5FDZ 5fe0 
5FE0 5fe1 
5FE1 5fe2 
5FE2 5fe3 
5FE3 5fe4 
5FE4 5fe5 
5FE5 5fe6 
5FE6 5fe7 
5FE7 5fe8 
5FE8 5fe9 
5FE9 5fea 
5FEA 5ffv 
5FFV 5ffw 
5FFW 5ffy 
5FFY 5fg4 
5FG4 5fg5 
5FG5 5fg6 
5FG6 5fh6 
5FH6 5fh7 
5FH7 5fh8 
5FH8 5fur 
5FUR 5g4r 
5G4R 5g4s 
5G4S 5hel 
5HEL 5hem 
5HEM 5hen 
5HEN 5hfq 
5HFQ 5hfr 
5HFR 5hjc 
5HJC 5hls 
5HLS 5hm0 
5HM0 5hrv 
5HRV 5hrw 
5HRW 5hrx 
5HRX 5i1q 
5I1Q 5i29 
5I29 5i40 
5I40 5i7x 
5I7X 5i7y 
5I7Y 5i80 
5I80 5i83 
5I83 5i86 
5I86 5i88 
5I88 5i89 
5I89 5i8b 
5I8B 5i8g 
5I8G 5ibn 
5IBN 5ig6 
5IG6 5igk 
5IGK 5igl 
5IGL 5igm 
5IGM 5ign 
5IGN 5ii1 
5II1 5ii2 
5II2 5iid 
5IID 5j0d 
5J0D 5ji8 
5JI8 5jwm 
5JWM 5k29 
5K29 5khm 
5KHM 5ko4 
5KO4 5ktu 
5KTU 5ktw 
5KTW 5ktx 
5KTX 5ku3 
5KU3 5l8t 
5L8T 5l8u 
5L8U 5l96 
5L96 5l97 
5L97 5l98 
5L98 5l99 
5L99 5lj0 
5LJ0 5lj1 
5LJ1 5lj2 
5LJ2 5lkt 
5LKT 5lku 
5LKU 5lkx 
5LKX 5lkz 
5LKZ 5luu 
5LUU 5lvq 
5LVQ 5lvr 
5LVR 5tb6 
5TB6 5tcm 
5TCM - Links (links to other resources describing this domain)
-
INTERPRO IPR001487 PFAM bromodomain PROSITE BROMODOMAIN_2