The domain within your query sequence starts at position 640 and ends at position 747; the E-value for the Biotin_carb_C domain shown below is 9.54e-26.

AARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGEN
REEAISNMVVALKELSIRGDFRTTVEYLVNLLETESFQNNDIDTGWLD

Biotin_carb_C

Biotin carboxylase C-terminal domain
Biotin_carb_C
SMART accession number:SM00878
Description: Biotin carboxylase is a component of the acetyl-CoA carboxylase multi-component enzyme which catalyses the first committed step in fatty acid synthesis in animals, plants and bacteria. Most of the active site residues reported in reference are in this C-terminal domain.
Interpro abstract (IPR005482):

Acetyl-CoA carboxylase is found in all animals, plants, and bacteria and catalyzes the first committed step in fatty acid synthesis. It is a multicomponent enzyme containing a biotin carboxylase activity, a biotin carboxyl carrier protein, and a carboxyltransferase functionality. The "B-domain" extends from the main body of the subunit where it folds into two alpha-helical regions and three strands of beta-sheet. Following the excursion into the B-domain, the polypeptide chain folds back into the body of the protein where it forms an eight-stranded antiparallel beta-sheet. In addition to this major secondary structural element, the C-terminal domain also contains a smaller three-stranded antiparallel beta-sheet and seven alpha-helices [ (PUBMED:7915138) ].

Family alignment:
View or

There are 58280 Biotin_carb_C domains in 58272 proteins in SMART's nrdb database.

Click on the following links for more information.