The domain within your query sequence starts at position 56 and ends at position 95; the E-value for the B3_4 domain shown below is 6e-14.

GASDVVLYKIDVPANRYDLLCLEGLARGLQVFKERIKAPV

The domain was found using the schnipsel database

B3_4

B3/4 domain
B3_4
SMART accession number:SM00873
Description: This domain is found in tRNA synthetase beta subunits as well as in some non tRNA synthetase proteins.
Interpro abstract (IPR005146):

This entry represents the B3/B4 domain found in tRNA synthetase beta subunits as well as in some non-tRNA synthetase proteins. This domain has a 3-layer structure, and contains a beta-sandwich fold of unusual topology, and contains a putative tRNA-binding structural motif [ (PUBMED:7664121) ]. In Thermus thermophilus, both the catalytic alpha- and the non-catalytic beta-subunits comprise the characteristic fold of the class II active-site domains. The presence of an RNA-binding domain, similar to that of the U1A spliceosomal protein, in the beta-subunit of tRNA synthetase indicates structural relationships among different families of RNA-binding proteins.

Aminoacyl-tRNA synthetases can catalyse editing reactions to correct errors produced during amino acid activation and tRNA esterification, in order to prevent the attachment of incorrect amino acids to tRNA. The B3/B4 domain of the beta subunit contains an editing site, which lies close to the active site on the alpha subunit [ (PUBMED:15526031) ]. Disruption of this site abolished tRNA editing, a process that is essential for faithful translation of the genetic code.

GO function:RNA binding (GO:0003723), phenylalanine-tRNA ligase activity (GO:0004826)
Family alignment:
View or

There are 29643 B3_4 domains in 29641 proteins in SMART's nrdb database.

Click on the following links for more information.