The domain within your query sequence starts at position 270 and ends at position 391; the E-value for the BBC domain shown below is 4e-11.
LKDKLTKSLAYILGNQDTVQTQICELEETIRHTEVSGQQAKEEVSQLVRGLGAVLEEKRA SLLQAIEECQQERLSRLSAQIHEHQSLLDGSGLVGYAQEVLKETDQPCFVQAAKQLHNRI AR
The domain was found using the schnipsel database
BBCB-Box C-terminal domain |
---|
SMART accession number: | SM00502 |
---|---|
Description: | Coiled coil region C-terminal to (some) B-Box domains |
Interpro abstract (IPR003649): | The B-box C-terminal domain is a coiled coil region C-terminal to (some) B-Box domains. It is found in transcription intermediary factor 1-alpha, which associates with DNA-bound estrogen receptors; ring finger protein, a putative transcriptional regulator; and the GTP-binding protein Ard-1. |
Family alignment: |
There are 6568 BBC domains in 6536 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Links (links to other resources describing this domain)