The domain within your query sequence starts at position 271 and ends at position 395; the E-value for the BBC domain shown below is 3e-13.

KDKLTKSLAYILGNQDTVQTQICELEETIRHTEVSGQQAKEEVSQLVRGLGAVLEEKRAS
LLQAIEECQQERLSRLSAQIHEHQSLLDGSGLVGYAQEVLKETDQPCFVQAAKQLHNRIA
RATEA

The domain was found using the schnipsel database

BBC

B-Box C-terminal domain
BBC
SMART accession number:SM00502
Description: Coiled coil region C-terminal to (some) B-Box domains
Interpro abstract (IPR003649):

The B-box C-terminal domain is a coiled coil region C-terminal to (some) B-Box domains. It is found in transcription intermediary factor 1-alpha, which associates with DNA-bound estrogen receptors; ring finger protein, a putative transcriptional regulator; and the GTP-binding protein Ard-1.

Family alignment:
View or

There are 6568 BBC domains in 6536 proteins in SMART's nrdb database.

Click on the following links for more information.