The domain within your query sequence starts at position 31 and ends at position 65; the E-value for the DM15 domain shown below is 1e-16.
NFRKEIFKDFQEETKKDYESGQLYGLEKFWAYLEY
The domain was found using the schnipsel database
DM15Tandem repeat in fly CG14066 (La related protein), human KIAA0731 and worm R144.7. Unknown function. |
---|
SMART accession number: | SM00684 |
---|---|
Description: | - |
Interpro abstract (IPR006607): | This repeat is found in proteins that have not been characterised. |
Family alignment: |
There are 4521 DM15 domains in 1532 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)