The domain within your query sequence starts at position 1401 and ends at position 1430; the E-value for the DUF1744 domain shown below is 2e-7.
VPEDMYQEHINEINTELSVPDIEGVYETQV
The domain was found using the schnipsel database
DUF1744 |
|---|
| SMART accession number: | SM01159 |
|---|---|
| Description: | This domain is found on the epsilon catalytic subunit of DNA polymerase. It is found C terminal to POLBc (SM00486). |
| Interpro abstract (IPR013697): | This domain is found on the catalytic subunit of DNA polymerase epsilon. It is found C-terminal to IPR006133 and IPR006134 . |
| GO process: | DNA replication (GO:0006260) |
| GO component: | nucleus (GO:0005634) |
| GO function: | zinc ion binding (GO:0008270), DNA-directed DNA polymerase activity (GO:0003887) |
| Family alignment: |
There are 1559 DUF1744 domains in 1558 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)