The domain within your query sequence starts at position 1401 and ends at position 1430; the E-value for the DUF1744 domain shown below is 2e-7.

VPEDMYQEHINEINTELSVPDIEGVYETQV

The domain was found using the schnipsel database

DUF1744

DUF1744
SMART accession number:SM01159
Description: This domain is found on the epsilon catalytic subunit of DNA polymerase. It is found C terminal to POLBc (SM00486).
Interpro abstract (IPR013697):

This domain is found on the catalytic subunit of DNA polymerase epsilon. It is found C-terminal to IPR006133 and IPR006134 .

GO process:DNA replication (GO:0006260)
GO component:nucleus (GO:0005634)
GO function:zinc ion binding (GO:0008270), DNA-directed DNA polymerase activity (GO:0003887)
Family alignment:
View or

There are 1559 DUF1744 domains in 1558 proteins in SMART's nrdb database.

Click on the following links for more information.