The domain within your query sequence starts at position 455 and ends at position 673; the E-value for the DUF4206 domain shown below is 1e-66.
SESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPAYRET ENGSFRVTSSSSQFSSRDSTQLSESGSAEDADDLEIQDADIRRSAVSNGKSSFSQNLSHC FLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHAD IYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQN
The domain was found using the schnipsel database
DUF4206 |
---|
SMART accession number: | SM01175 |
---|---|
Description: | This is a family of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain,SM00233. |
Interpro abstract (IPR025258): | This entry represents a domain found in a group of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain. |
Family alignment: |
There are 3211 DUF4206 domains in 3211 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)