The domain within your query sequence starts at position 57 and ends at position 137; the E-value for the Fapy_DNA_glyco domain shown below is 5e-34.
NAKDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPREGENRAGA SPALAVQLTRDLICFYDSSVE
The domain was found using the schnipsel database
Fapy_DNA_glycoFormamidopyrimidine-DNA glycosylase N-terminal domain |
---|
SMART accession number: | SM00898 |
---|---|
Description: | This entry represents the catalytic domain of DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Most damage to bases in DNA is repaired by the base excision repair pathway (PUBMED:15588838). These enzymes are primarily from bacteria, and have both DNA glycosylase activity and AP lyase activity. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; ) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; ). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge (PUBMED:10921868). The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes (PUBMED:10921868). Fpg binds one ion of zinc at the C-terminus, which contains four conserved and essential cysteines (PUBMED:8473347), (PUBMED:7704272). Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine (PUBMED:15232006). These protein contains three structural domains: an N-terminal catalytic core domain, a central helix-two turn-helix (H2TH) module and a C-terminal zinc finger (see PDB:1K82) (PUBMED:11912217). The N-terminal catalytic domain and the C-terminal zinc finger straddle the DNA with the long axis of the protein oriented roughly orthogonal to the helical axis of the DNA. Residues that contact DNA are located in the catalytic domain and in a beta-hairpin loop formed by the zinc finger (PUBMED:12055620). |
Interpro abstract (IPR012319): | This entry represents the catalytic domain of DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Most damage to bases in DNA is repaired by the base excision repair pathway [ (PUBMED:15588838) ]. These enzymes are primarily from bacteria, and have both DNA glycosylase activity ( EC 3.2.2 ) and AP lyase activity ( EC 4.2.99.18 ). Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; EC 3.2.2.23 ) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; EC 4.2.99.18 ). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge [ (PUBMED:10921868) ]. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes [ (PUBMED:10921868) ]. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines [ (PUBMED:8473347) (PUBMED:7704272) ]. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above ( EC 3.2.2 EC 4.2.99.18 ), but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [ (PUBMED:15232006) ]. These protein contains three structural domains: an N-terminal catalytic core domain, a central helix-two turn-helix (H2TH) module and a C-terminal zinc finger [ (PUBMED:11912217) ]. The N-terminal catalytic domain and the C-terminal zinc finger straddle the DNA with the long axis of the protein oriented roughly orthogonal to the helical axis of the DNA. Residues that contact DNA are located in the catalytic domain and in a beta-hairpin loop formed by the zinc finger [ (PUBMED:12055620) ]. |
GO process: | base-excision repair (GO:0006284) |
GO function: | damaged DNA binding (GO:0003684), zinc ion binding (GO:0008270), hydrolase activity, hydrolyzing N-glycosyl compounds (GO:0016799), DNA-(apurinic or apyrimidinic site) endonuclease activity (GO:0003906) |
Family alignment: |
There are 28602 Fapy_DNA_glyco domains in 28602 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)