The domain within your query sequence starts at position 445 and ends at position 504; the E-value for the HNHc domain shown below is 4e-6.

RTSTQETPYKCNECGKFFTCSSSLKICHENCTGERLHKSNNCGKSFIQSSKLQVNYRIHT

The domain was found using the schnipsel database

HNHc

HNH nucleases
HNHc
SMART accession number:SM00507
Description: -
Interpro abstract (IPR003615):

This domain is found in HNH family of nucleases that includes yeast intron 1 protein, MutS, and bacterial colicins, pyocins and endonuclease HphI. They are found in bacteria, viruses and eukaryotes.

Family alignment:
View or

There are 90127 HNHc domains in 89843 proteins in SMART's nrdb database.

Click on the following links for more information.