The domain within your query sequence starts at position 375 and ends at position 405; the E-value for the LRR domain shown below is 7e-9.

SPKLRMLDLRGCARVTPSGLCHLPCQELEQL

The domain was found using the schnipsel database

LRR

Leucine-rich repeats, outliers
LRR
SMART accession number:SM00370
Description: -
Family alignment:
View or

There are 1323917 LRR domains in 210080 proteins in SMART's nrdb database.

Click on the following links for more information.