The domain within your query sequence starts at position 47 and ends at position 123; the E-value for the LU domain shown below is 4e-51.

FKCFTCEKAADNYECNRWAPDIYCPRDTRYCYTQHTMEVTGNSISVTKRCVPLEECLSTG
CRDSEHEGYKICTSCCE

The domain was found using the schnipsel database

LU

Ly-6 antigen / uPA receptor -like domain
LU
SMART accession number:SM00134
Description: Three-fold repeated domain in urokinase-type plasminogen activator receptor; occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59, thymocyte B cell antigen, Sgp-2). Topology of these domains is similar to that of snake venom neurotoxins.
Interpro abstract (IPR016054):

A variety of GPI-linked cell-surface glycoproteins are composed of one or more copies of a conserved domain of about 100 amino-acid residues [ (PUBMED:1850423) (PUBMED:8394346) ]. Among these proteins, U-PAR contains three tandem copies of the domain, while all the others are made up of a single domain.

As shown in the following schematic, this conserved domain contains 10 cysteine residues involved in five disulphide bonds - in U-PAR, the first copy of the domain lacks the fourth disulphide bond.


+------+ +------------------------+ +---+
| | | | | |
xCxxCxxxxxxCxxxxxCxxxxxCxxxxxxxxxxxxxxxxxxCxxxxCxxxxxxxxxxxxxxCCxxxCxxxxxxxx
| | | |
+---------------------+ +--------------+

'C': conserved cysteine involved in a disulphide bond.

This entry represents a three-fold repeated domain in urokinase-type plasminogen activator receptor (uPAR) that occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59, thymocyte B cell antigen, Sgp-2).

Family alignment:
View or

There are 5680 LU domains in 4879 proteins in SMART's nrdb database.

Click on the following links for more information.