The domain within your query sequence starts at position 1195 and ends at position 1266; the E-value for the POLBc domain shown below is 7e-21.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 97358535 ) for details.

Catalytic residues
PositionAmino acidPresent?
DomainProtein
N/AN/ADNo
N/AN/ADNo
N/AN/ADNo
IVMAQASENSLSLCTPDMEDIGLTKPHHSTVPVATKRKRVWETQKESQDIALTVPWQEVL
GQPPSLGTTQEE

The domain was found using the schnipsel database

POLBc

DNA polymerase type-B family
POLBc
SMART accession number:SM00486
Description: DNA polymerase alpha, delta, epsilon and zeta chain (eukaryota), DNA polymerases in archaea, DNA polymerase II in e. coli, mitochondrial DNA polymerases and and virus DNA polymerases
Interpro abstract (IPR006172):

DNA is the biological information that instructs cells how to exist in an ordered fashion: accurate replication is thus one of the most important events in the life cycle of a cell. This function is performed by DNA- directed DNA-polymerases ( EC 2.7.7.7 ) by adding nucleotide triphosphate (dNTP) residues to the 5'-end of the growing chain of DNA, using a complementary DNA chain as a template. Small RNA molecules are generally used as primers for chain elongation, although terminal proteins may also be used for the de novo synthesis of a DNA chain. Even though there are 2 different methods of priming, these are mediated by 2 very similar polymerases classes, A and B, with similar methods of chain elongation.

A number of DNA polymerases have been grouped under the designation of DNA polymerase family B. Six regions of similarity (numbered from I to VI) are found in all or a subset of the B family polymerases. The most conserved region (I) includes a conserved tetrapeptide with two aspartate residues. Its function is not yet known. However, it has been suggested [ (PUBMED:2461550) ] that it may be involved in binding a magnesium ion. All sequences in the B family contain a characteristic DTDS motif, and possess many functional domains, including a 5'-3' elongation domain, a 3'-5' exonuclease domain [ (PUBMED:8679562) ], a DNA binding domain, and binding domains for both dNTP's and pyrophosphate [ (PUBMED:9757117) ].

GO function:nucleotide binding (GO:0000166), DNA-directed DNA polymerase activity (GO:0003887), nucleic acid binding (GO:0003676)
Family alignment:
View or

There are 13646 POLBc domains in 13642 proteins in SMART's nrdb database.

Click on the following links for more information.