The domain within your query sequence starts at position 850 and ends at position 891; the E-value for the PSI domain shown below is 9e-20.

NCAMGSPDCSQCLGREDLGHLCVWNDGCRLRGPLQPLPGTCP

The domain was found using the schnipsel database

PSI

domain found in Plexins, Semaphorins and Integrins

• SMART accession number: SM00423
• Description: -
• Interpro abstract (IPR016201):

  This domain is found in several different extracellular receptors, including plexins, which are involved in the development of neural and epithelial tissues [ (PUBMED:17855350) ]; in semaphorins, which regulate axon guidance, immune function and angiogenesis [ (PUBMED:12958590) ]; in integrins, which are important Metazoan adhesion receptors that transmit conformational change bidirectionally across the membrane (integrin alpha and beta subunits form a head and two long legs in the ectodomain and span the membrane) [ (PUBMED:15378069) ]; and in hepatocyte growth factor receptor, which plays important roles in normal development and in tumour growth and metastasis [ (PUBMED:15167892) ].

There are 31672 PSI domains in 20788 proteins in SMART's nrdb database.

Disease (disease genes where sequence variants are found in this domain)

SwissProt sequences and OMIM curated human diseases associated with missense mutations within the PSI domain.

Protein	Disease
Integrin beta-3 (P05106) (SMART)	OMIM:173470: Glanzmann thrombasthenia, type B
Integrin beta-4 (P16144) (SMART)	OMIM:147557: Epidermolysis bullosa, junctional, with pyloric atresia OMIM:226730: Epidermolysis bullosa, generalized atrophic benign OMIM:226650:

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
38.12	map04360	Axon guidance
12.71	map04510	Focal adhesion
12.50	map04810	Regulation of actin cytoskeleton
10.83	map04512	ECM-receptor interaction
6.04	map04514	Cell adhesion molecules (CAMs)
3.54	map04670	Leukocyte transendothelial migration
1.88	map04520	Adherens junction
1.88	map05222	Small cell lung cancer
1.88	map05120	Epithelial cell signaling in Helicobacter pylori infection
1.88	map05210	Colorectal cancer
1.88	map04060	Cytokine-cytokine receptor interaction
1.88	map05211	Renal cell carcinoma
1.88	map05218	Melanoma
1.67	map04650	Natural killer cell mediated cytotoxicity
1.46	map04640	Hematopoietic cell lineage

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with PSI domain which could be assigned to a KEGG orthologous group, and not all proteins containing PSI domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of PSI domains in PDB

PDB code	Title
1jv2	CRYSTAL STRUCTURE OF THE EXTRACELLULAR SEGMENT OF INTEGRIN ALPHAVBETA3
1l5g	CRYSTAL STRUCTURE OF THE EXTRACELLULAR SEGMENT OF INTEGRIN AVB3 IN COMPLEX WITH AN ARG-GLY-ASP LIGAND
1m1x	CRYSTAL STRUCTURE OF THE EXTRACELLULAR SEGMENT OF INTEGRIN ALPHA VBETA3 BOUND TO MN2+
1olz	The ligand-binding face of the semaphorins revealed by the high resolution crystal structure of SEMA4D
1shy	The Crystal Structure of HGF beta-chain in Complex with the Sema Domain of the Met Receptor.
1ssl	Solution structure of the PSI domain from the Met receptor
1tye	Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
1u8c	A novel adaptation of the integrin PSI domain revealed from its crystal structure
1yuk	The crystal structure of the PSI/Hybrid domain/ I-EGF1 segment from the human integrin beta2 at 1.8 resolution
2p26	Structure of the PHE2 and PHE3 fragments of the integrin beta2 subunit
2p28	Structure of the PHE2 and PHE3 fragments of the integrin beta2 subunit
2uzx	Structure of the human receptor tyrosine kinase Met in complex with the Listeria monocytogenes invasion protein InlB: Crystal form I
2uzy	Structure of the human receptor tyrosine kinase Met in complex with the Listeria monocytogenes invasion protein inlb: low resolution, Crystal form II
2vc2	Re-refinement of Integrin AlphaIIbBeta3 Headpiece Bound to Antagonist L-739758
2vdk	Re-refinement of Integrin AlphaIIbBeta3 Headpiece
2vdl	Re-refinement of Integrin AlphaIIbBeta3 Headpiece
2vdm	Re-refinement of Integrin AlphaIIbBeta3 Headpiece Bound to Antagonist Tirofiban
2vdn	Re-refinement of Integrin AlphaIIbBeta3 Headpiece Bound to Antagonist Eptifibatide
2vdo	Integrin AlphaIIbBeta3 Headpiece Bound to Fibrinogen Gamma chain peptide, HHLGGAKQAGDV
2vdp	Integrin AlphaIIbBeta3 Headpiece Bound to Fibrinogen Gamma chain peptide,LGGAKQAGDV
2vdq	Integrin AlphaIIbBeta3 Headpiece Bound to a Chimeric Fibrinogen Gamma chain peptide, HHLGGAKQRGDV
2vdr	Integrin AlphaIIbBeta3 Headpiece Bound to Fibrinogen Gamma chain chimera peptide, LGGAKQRGDV
3afc	Mouse Semaphorin 6A extracellular domain
3al8	Plexin A2 / Semaphorin 6A complex
3al9	Mouse Plexin A2 extracellular domain
3fcs	Structure of complete ectodomain of integrin aIIBb3
3fcu	Structure of headpiece of integrin aIIBb3 in open conformation
3ije	Crystal structure of the complete integrin alhaVbeta3 ectodomain plus an Alpha/beta transmembrane fragment
3k6s	Structure of integrin alphaXbeta2 ectodomain
3k71	Structure of integrin alphaX beta2 ectodomain
3k72	Structure of integrin alphaX beta2
3nid	The Closed Headpiece of Integrin alphaIIB beta3 and its Complex with an alpahIIB beta3 -Specific Antagonist That Does Not Induce Opening
3nif	The Closed Headpiece of Integrin IIb 3 and its Complex with an IIb 3 -Specific Antagonist That Does Not Induce Opening
3nig	The Closed Headpiece of Integrin IIb 3 and its Complex with an IIb 3 -Specific Antagonist That Does Not Induce Opening
3nvn	Molecular mechanism of guidance cue recognition
3nvq	Molecular mechanism of guidance cue recognition
3okt	Mouse Plexin A2, extracellular domains 1-4
3okw	Mouse Semaphorin 6A, extracellular domains 1-2
3oky	Plexin A2 in complex with Semaphorin 6A
3ol2	Receptor-ligand structure of Human Semaphorin 4D with Plexin B1.
3t3m	A Novel High Affinity Integrin alphaIIbbeta3 Receptor Antagonist That Unexpectedly Displaces Mg2+ from the beta3 MIDAS
3t3p	A Novel High Affinity Integrin alphaIIbbeta3 Receptor Antagonist That Unexpectedly Displaces Mg2+ from the beta3 MIDAS
3v4p	crystal structure of a4b7 headpiece complexed with Fab ACT-1
3v4v	crystal structure of a4b7 headpiece complexed with Fab ACT-1 and RO0505376
3vi3	Crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
3vi4	Crystal structure of alpha5beta1 integrin headpiece in complex with RGD peptide
3zdx	Integrin alphaIIB beta3 headpiece and RGD peptide complex
3zdy	Integrin alphaIIB beta3 headpiece and RGD peptide complex
3zdz	Integrin alphaIIB beta3 headpiece and RGD peptide complex
3ze0	Integrin alphaIIB beta3 headpiece and RGD peptide complex
3ze1	Integrin alphaIIB beta3 headpiece and RGD peptide complex
3ze2	Integrin alphaIIB beta3 headpiece and RGD peptide complex
4cak	Three-dimensional reconstruction of intact human integrin alphaIIbbeta3 in a phospholipid bilayer nanodisc
4fww	Crystal structure of the Sema-PSI extracellular domains of human RON receptor tyrosine kinase
4g1e	Crystal structure of integrin alpha V beta 3 with coil-coiled tag.
4g1m	Re-refinement of alpha V beta 3 structure
4gz8	Mouse Semaphorin 3A, domains Sema-PSI-IG
4gza	Complex of mouse Plexin A2 - Semaphorin 3A - Neuropilin-1
4k3j	Crystal structure of Onartuzumab Fab in complex with MET and HGF-beta
4mmx	Integrin AlphaVBeta3 ectodomain bound to the tenth domain of Fibronectin
4mmy	Integrin AlphaVBeta3 ectodomain bound to the tenth domain of Fibronectin with the IAKGDWND motif
4mmz	Integrin AlphaVBeta3 ectodomain bound to an antagonistic tenth domain of Fibronectin
4neh	An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
4nen	An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
4o02	AlphaVBeta3 integrin in complex with monoclonal antibody FAB fragment.
4o3t	4O3T
4o3u	4O3U
4qt8	4QT8
4um8	4UM8
4um9	4UM9
4wjk	4WJK
4wk0	4WK0
4wk2	4WK2
4wk4	4WK4
4z7n	4Z7N
4z7o	4Z7O
4z7q	4Z7Q
5e6r	5E6R
5e6s	5E6S
5e6u	5E6U
5e6v	5E6V
5e6w	5E6W
5e6x	5E6X
5es4	5ES4
5hdb	5HDB
5l56	5L56
5l59	5L59
5l5c	5L5C
5l5g	5L5G
5l5k	5L5K
5l5l	5L5L
5l5m	5L5M
5l5n	5L5N

Links (links to other resources describing this domain)

• INTERPRO: IPR016201