The domain within your query sequence starts at position 125 and ends at position 156; the E-value for the UBCc domain shown below is 9e-12.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 97407928 ) for details.

Catalytic residues
PositionAmino acidPresent?
DomainProtein
N/AN/ACNo
RTAFNNNVSVAYECLSASGRKKKPGLDGRTYS

The domain was found using the schnipsel database

UBCc

Ubiquitin-conjugating enzyme E2, catalytic domain homologues
UBCc
SMART accession number:SM00212
Description: Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. This pathway functions in regulating many fundamental processes required for cell viability.TSG101 is one of several UBC homologues that lacks this active site cysteine.
Family alignment:
View or

There are 43578 UBCc domains in 43296 proteins in SMART's nrdb database.

Click on the following links for more information.