The domain within your query sequence starts at position 203 and ends at position 243; the E-value for the UBCc domain shown below is 8e-13.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 97407928 ) for details.

Catalytic residues
Position		Amino acid	Present?
Domain	Protein
N/A	N/A	C	No

HYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQDYLN

The domain was found using the schnipsel database

UBCc

Ubiquitin-conjugating enzyme E2, catalytic domain homologues

• SMART accession number: SM00212
• Description: Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. This pathway functions in regulating many fundamental processes required for cell viability.TSG101 is one of several UBC homologues that lacks this active site cysteine.

There are 43578 UBCc domains in 43296 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Binding / catalysis: protein-binding, ubiquitin-conjugating

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Cook WJ, Martin PD, Edwards BF, Yamazaki RK, Chau V
• Crystal structure of a class I ubiquitin conjugating enzyme (Ubc7) from Saccharomyces cerevisiae at 2.9 angstroms resolution.
• Biochemistry. 1997; 36: 1621-7

Ubiquitin-conjugating enzymes are a family of related proteins that participate in the ubiquitination of proteins. Previous studies on the crystal structures of Saccharomyces cerevisiae Ubc4 and Arabidopsis thaliana Ubc1 indicated that the smallest enzymes (class I), which consist entirely of the conserved core domain, share a common tertiary fold. Here we report the three-dimensional structure of the S. cerevisiae class I enzyme encoded by the UBC7 gene. The crystal structure has been solved using molecular replacement techniques and refined by simulated annealing to an R-factor of 0.183 at 2.93 A resolution. Bond lengths and angles in the molecule have root-mean-square deviations from ideal values of 0.016 A and 2.3 degrees, respectively. Ubc7 is an alpha/beta protein with four alpha-helices and a four-stranded antiparallel beta-sheet. With the exception of two regions where extra residues are present, the tertiary folding of Ubc7 is similar to those of the other two enzymes. The ubiquitin-accepting cysteine is located in a cleft between two loops. One of these loops is nonconserved, as this region of the Ubc7 molecule differs from the other two enzymes by having 13 extra residues. There is also a second single amino acid insertion that alters the orientation of the turn between the first two beta-strands. Analysis of the 13 ubiquitin-conjugating enzyme sequences in S. cerevisiae indicates that there may be two other regions where extra residues could be inserted into the common tertiary fold. Both of these other regions exhibit significant deviations in the superposition of the three structures and, like the two insertion regions in Ubc7, may represent hypervariable regions within a common tertiary fold. As ubiquitin-conjugating enzymes interact with different substrates or other accessory proteins in the ubiquitination pathway, these variable surface regions may confer distinct specificity to individual enzymes.

• Hatakeyama S, Jensen JP, Weissman AM
• Subcellular localization and ubiquitin-conjugating enzyme (E2) interactions of mammalian HECT family ubiquitin protein ligases.
• J Biol Chem. 1997; 272: 15085-92

In most instances, the transfer of ubiquitin to target proteins is catalyzed by the action of ubiquitin protein ligases (E3s). Full-length cDNAs encoding murine E6-associated protein (mE6-AP) as well as Nedd-4, a protein that is homologous to E6-AP in its C terminus, were cloned. Nedd-4 and mouse E6-AP are both enzymatically active E3s and function with members of the UbcH5 family of E2s. Mouse E6-AP, like its human counterpart, ubiquitinates p53 in the presence of human papilloma virus E6 protein, while Nedd-4 does not. Consistent with its role in p53 ubiquitination, mE6-AP was found both in the nucleus and cytosol, while Nedd-4 was found only in the cytosol. Binding studies implicate a 150-amino acid region that is 40% identical between mE6-AP and Nedd-4 as a binding site for the C-terminal portion of an E2 enzyme (UbcH5B). Nedd-4 was determined to have a second nonoverlapping E2 binding site that recognizes the first 67 amino acids of UbcH5B but not the more C-terminal portion of this E2. These findings provide the first demonstration of physical interactions between mammalian E2s and E3s and establish that these interactions occur independently of ubiquitin and an intact E3 catalytic domain. Furthermore, the presence of two E2 binding sites within Nedd-4 suggests models for ubiquitination involving multiple E2 enzymes associated with E3s.

• Koonin EV, Abagyan RA
• TSG101 may be the prototype of a class of dominant negative ubiquitin regulators.
• Nat Genet. 1997; 16: 330-1

• Kumar S, Kao WH, Howley PM
• Physical interaction between specific E2 and Hect E3 enzymes determines functional cooperativity.
• J Biol Chem. 1997; 272: 13548-54

The cellular protein E6AP functions as an E3 ubiquitin protein ligase in the E6-dependent ubiquitination of p53. E6AP is a member of a family of functionally related E3 proteins that share a conserved carboxyl-terminal region called the Hect domain. Although several different E2 ubiquitin-conjugating enzymes have been shown to function with E6AP in the E6-dependent ubiquitination of p53 in vitro, the E2s that cooperate with E6AP in the ubiquitination of its normal substrates are presently unknown. Moreover, the basis of functional cooperativity between specific E2 and Hect E3 proteins has not yet been determined. Here we report the cloning of a new human E2, designated UbcH8, that was identified in a two-hybrid screen through specific interaction with E6AP. We demonstrate that UbcH7, an E2 closely related to UbcH8, can also bind to E6AP. The region of E6AP involved in complex formation with UbcH8 and UbcH7 was mapped to its Hect domain. Furthermore, we show that UbcH5 and UbcH6, two highly homologous E2s that were deficient for interaction with E6AP, could associate efficiently with another Hect-E3 protein, RSP5. Finally, only the E6AP-interacting E2s could function in conjunction with E6AP in the ubiquitination of an E6 independent substrate of E6AP, whereas the noninteracting E2s could not. Taken together, these studies demonstrate for the first time complex formation between specific human E2s and the Hect domain family of E3 proteins and suggest that selective physical interaction between E2 and E3 enzymes forms the basis of specificity for functionally distinct E2:E3 combinations.

• Ponting CP, Aravind L
• PAS: a multifunctional domain family comes to light.
• Curr Biol. 1997; 7: 6747-6747

• Ponting CP, Cai YD, Bork P
• The breast cancer gene product TSG101: a regulator of ubiquitination?
• J Mol Med. 1997; 75: 467-9

Sequence analysis is a powerful tool to obtain structural and functional information about genes and their products. Here we show that TSG101, a gene subjected to somatic mutations in breast cancer, contains an amino terminal domain that is a homologue of ubiquitin conjugating enzymes (UBCs) and not, as previously proposed, DNA-binding domains. As the UBC active site residue is replaced in the TSG101 sequence in a similar manner to several other members of the UBC family, we propose a role for TSG101 in regulating the ubiquitination of short-lived gene products.

• Cook WJ, Jeffrey LC, Xu Y, Chau V
• Tertiary structures of class I ubiquitin-conjugating enzymes are highly conserved: crystal structure of yeast Ubc4.
• Biochemistry. 1993; 32: 13809-17

The three-dimensional structure of a yeast ubiquitin-conjugating enzyme, encoded by the Saccharomyces cerevisiae UBC4 gene, has been determined at 2.7 A. The structure was solved using molecular replacement techniques and refined by simulated annealing to an R-factor of 0.198. Bond lengths and angles in the molecule have root mean square deviations from ideal values of 0.018 A and 4.0 degrees, respectively. Ubc4 is an alpha/beta protein with four alpha-helices and a four-stranded antiparallel beta-sheet. The ubiquitin-accepting cysteine is located in a cleft between two loops. Comparison with the recently determined structure of a different plant enzyme suggests that class I ubiquitin-conjugating enzymes are highly conserved in their three-dimensional folding. Except for two extra residues at the N- and the C-terminus of the plant enzyme, the C alpha atoms of the two enzymes can be superimposed with a root mean square deviation of only 1.52 A. Greater variations are found between the surfaces of the two molecules, as most of the identical residues between the two enzymes are either buried or clustered on the surface that lies adjacent to the ubiquitin-accepting cysteine. We suggest that this conserved surface functions in protein-protein binding during ubiquitin thiol ester formation.

• Cook WJ, Jeffrey LC, Sullivan ML, Vierstra RD
• Three-dimensional structure of a ubiquitin-conjugating enzyme (E2).
• J Biol Chem. 1992; 267: 15116-21

The x-ray crystal structure of a recombinant ubiquitin-conjugating enzyme (E2) encoded by the UBC1 gene of the plant Arabidopsis thaliana has been determined with the use of multiple isomorphous replacement techniques and refined at 2.4-A resolution by simulated annealing and restrained least-squares. This E2 is an alpha/beta protein, with four alpha-helices and a four-stranded antiparallel beta-sheet. The NH2 and COOH termini, which may be important for interaction with other enzymes and substrates in the ubiquitin-conjugation pathway, are on the opposite side of the molecule from the cysteine residue that binds to the COOH terminus of ubiquitin. This structure should now allow for the rational analysis of E2 function by in vitro mutagenesis and facilitate the effective design of E2s with unique specificities or catalytic functions.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
75.69	map04120	Ubiquitin mediated proteolysis
20.41	map05020	Parkinson's disease
3.67	map05040	Huntington's disease
0.23	map00380	Tryptophan metabolism

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with UBCc domain which could be assigned to a KEGG orthologous group, and not all proteins containing UBCc domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of UBCc domains in PDB

PDB code	Title
1a3s	HUMAN UBC9
1ayz	CRYSTAL STRUCTURE OF THE SACCHAROMYCES CEREVISIAE UBIQUITIN-CONJUGATING ENZYME RAD6 (UBC2) AT 2.6A RESOLUTION
1c4z	STRUCTURE OF E6AP: INSIGHTS INTO UBIQUITINATION PATHWAY
1fbv	STRUCTURE OF A CBL-UBCH7 COMPLEX: RING DOMAIN FUNCTION IN UBIQUITIN-PROTEIN LIGASES
1fxt	STRUCTURE OF A CONJUGATING ENZYME-UBIQUITIN THIOLESTER COMPLEX
1fzy	CRYSTAL STRUCTURE OF SACCHAROMYCES CEREVISIAE UBIQUITIN CONJUGATING ENZYME 1
1i7k	CRYSTAL STRUCTURE OF HUMAN MITOTIC-SPECIFIC UBIQUITIN-CONJUGATING ENZYME, UBCH10
1j74	Crystal Structure of Mms2
1j7d	Crystal Structure of hMms2-hUbc13
1jas	HsUbc2b
1jat	Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
1jbb	Ubiquitin Conjugating Enzyme, Ubc13
1kpp	Structure of the Tsg101 UEV domain
1kpq	Structure of the Tsg101 UEV domain
1kps	Structural Basis for E2-mediated SUMO conjugation revealed by a complex between ubiquitin conjugating enzyme Ubc9 and RanGAP1
1m4p	Structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP ""late domain"" peptide, DYANA Ensemble
1m4q	STRUCTURE OF THE TSG101 UEV DOMAIN IN COMPLEX WITH A HIV-1 PTAP ""LATE DOMAIN"" PEPTIDE, CNS ENSEMBLE
1pzv	Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans
1q34	Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans
1qcq	UBIQUITIN CONJUGATING ENZYME
1s1q	TSG101(UEV) domain in complex with Ubiquitin
1tte	The Structure of a Class II ubiquitin-conjugating enzyme, Ubc1.
1u9a	HUMAN UBIQUITIN-CONJUGATING ENZYME UBC9
1u9b	MURINE/HUMAN UBIQUITIN-CONJUGATING ENZYME UBC9
1ur6	NMR based structural model of the UbcH5B-CNOT4 complex
1uzx	A complex of the Vps23 UEV with ubiquitin
1w4u	NMR solution structure of the ubiquitin conjugating enzyme UbcH5B
1wzv	Crystal Structure of UbcH8
1wzw	Crystal Structure of UbcH8
1x23	Crystal structure of ubch5c
1y6l	Human ubiquitin conjugating enzyme E2E2
1y8x	Structural basis for recruitment of Ubc12 by an E2-binding domain in NEDD8's E1
1yf9	Structural analysis of Leishmania major ubiquitin conjugating enzyme E2
1yh2	Ubiquitin-Conjugating Enzyme HSPC150
1yla	Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
1yrv	Novel Ubiquitin-Conjugating Enzyme
1z2u	The 1.1A crystallographic structure of ubiquitin-conjugating enzyme (ubc-2) from Caenorhabditis elegans: functional and evolutionary significance
1z3d	Protein crystal growth improvement leading to the 2.5A crystallographic structure of ubiquitin-conjugating enzyme (ubc-1) from Caenorhabditis elegans
1z5s	Crystal structure of a complex between UBC9, SUMO-1, RANGAP1 and NUP358/RANBP2
1zdn	Ubiquitin-conjugating enzyme E2S
1zgu	Solution structure of the human Mms2-Ubiquitin complex
1zuo	Structure of Human Ubiquitin-Conjugating Enzyme (UBCi) Involved in Embryo Attachment and Implantation
2a4d	Structure of the human ubiquitin-conjugating enzyme E2 variant 1 (UEV-1)
2a7l	Structure of the human hypothetical ubiquitin-conjugating enzyme, LOC55284
2aak	UBIQUITIN CONJUGATING ENZYME FROM ARABIDOPSIS THALIANA
2awf	Structure of human Ubiquitin-conjugating enzyme E2 G1
2ayv	Crystal structure of a putative ubiquitin-conjugating enzyme E2 from Toxoplasma gondii
2bep	Crystal structure of ubiquitin conjugating enzyme E2-25K
2bf8	Crystal structure of SUMO modified ubiquitin conjugating enzyme E2- 25K
2c2v	Crystal structure of the CHIP-UBC13-UEV1a complex
2c4p	Crystal structure of human ubiquitin-conjugating enzyme UbcH5A
2clw	Crystal structure of human ubiquitin-conjugating enzyme UbcH5B
2cyx	Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7)
2e2c	E2-C, AN UBIQUITIN CONJUGATING ENZYME REQUIRED FOR THE DESTRUCTION OF MITOTIC CYCLINS
2edi	Solution structure of the UQ_con domain from human NEDD8-conjugating enzyme NCE2
2eke	Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
2esk	Human Ubiquitin-Conjugating Enzyme (E2) UbcH5b, wild-type
2eso	Human Ubiquitin-Conjugating Enzyme (E2) UbcH5b mutant Ile37Ala
2esp	Human ubiquitin-conjugating enzyme (E2) UbcH5b mutant Ile88Ala
2esq	Human Ubiquitin-Conjugating Enzyme (E2) UbcH5b mutant Ser94Gly
2f0r	Crystallographic structure of human Tsg101 UEV domain
2f4w	Human ubiquitin-conjugating enzyme E2 J2
2f4z	Toxoplasma gondii ubiquitin conjugating enzyme TgTwinScan_2721- E2 domain
2fo3	Plasmodium vivax ubiquitin conjugating enzyme E2
2fuh	Solution Structure of the UbcH5c/Ub Non-covalent Complex
2gjd	Distinct functional domains of Ubc9 dictate cell survival and resistance to genotoxic stress
2gmi	Mms2/Ubc13~Ubiquitin
2grn	Crystal Structure of human RanGAP1-Ubc9
2gro	Crystal Structure of human RanGAP1-Ubc9-N85Q
2grp	Crystal Structure of human RanGAP1-Ubc9-Y87A
2grq	Crystal Structure of human RanGAP1-Ubc9-D127A
2grr	Crystal Structure of human RanGAP1-Ubc9-D127S
2h2y	Crystal structure of ubiquitin conjugating enzyme E2 from plasmodium falciparum
2hlw	Solution Structure of the Human Ubiquitin-conjugating Enzyme Variant Uev1a
2kjh	NMR based structural model of the UBCH8-UBIQUITIN complex
2kly	Solution structure of human ubiquitin conjugating enzyme Ube2g2
2lxp	NMR structure of two domains in ubiquitin ligase gp78, RING and G2BR, bound to its conjugating enzyme Ube2g
2mt6	2MT6
2nvu	Structure of APPBP1-UBA3~NEDD8-NEDD8-MgATP-Ubc12(C111A), a trapped ubiquitin-like protein activation complex
2o25	Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9
2ob4	Human Ubiquitin-Conjugating Enzyme CDC34
2onu	Plasmodium falciparum ubiquitin conjugating enzyme PF10_0330, putative homologue of human UBE2H
2oxq	Structure of the UbcH5 :CHIP U-box complex
2pe6	Non-covalent complex between human SUMO-1 and human Ubc9
2pwq	Crystal structure of a putative ubiquitin conjugating enzyme from Plasmodium yoelii
2px9	The intrinsic affinity between E2 and the Cys domain of E1 in Ubiquitin-like modifications
2q0v	Crystal structure of ubiquitin conjugating enzyme E2, putative, from Plasmodium falciparum
2qgx	Ubiquitin-conjugating enzyme E2Q
2r0j	Crystal structure of the putative ubiquitin conjugating enzyme, PFE1350c, from Plasmodium falciparum
2ucz	UBIQUITIN CONJUGATING ENZYME (UBC7) FROM SACCHAROMYCES CEREVISIAE
2uyz	Non-covalent complex between Ubc9 and SUMO1
2vrr	Structure of SUMO modified Ubc9
2xwu	CRYSTAL STRUCTURE OF IMPORTIN 13 - UBC9 COMPLEX
2y4w	Solution structure of human ubiquitin conjugating enzyme Rad6b
2y9m	Pex4p-Pex22p structure
2y9p	Pex4p-Pex22p mutant II structure
2yb6	Native human Rad6
2ybf	Complex of Rad18 (Rad6 binding domain) with Rad6b
2yho	The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor
2z5d	Human ubiquitin-conjugating enzyme E2 H
3a33	UbcH5b~Ubiquitin Conjugate
3a4s	The crystal structure of the SLD2:Ubc9 complex
3bzh	Crystal structure of human ubiquitin-conjugating enzyme E2 E1
3ceg	Crystal structure of the UBC domain of baculoviral IAP repeat-containing protein 6
3e46	Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington interacting protein 2) M172A mutant
3e95	Crystal Structure of the Plasmodium Falciparum ubiquitin conjugating enzyme complex, PfUBC13-PfUev1a
3eb6	Structure of the cIAP2 RING domain bound to UbcH5b
3f92	Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington Interacting Protein 2) M172A mutant crystallized at pH 8.5
3fn1	E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.
3fsh	Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of ubiquitin ligase gp78
3h8k	Crystal structure of Ube2g2 complxed with the G2BR domain of gp78 at 1.8-A resolution
3hct	Crystal structure of TRAF6 in complex with Ubc13 in the P1 space group
3hcu	Crystal structure of TRAF6 in complex with Ubc13 in the C2 space group
3jvz	E2~Ubiquitin-HECT
3jw0	E2~Ubiquitin-HECT
3k9o	The crystal structure of E2-25K and UBB+1 complex
3k9p	The crystal structure of E2-25K and ubiquitin complex
3l1y	Crystal structure of human UBC4 E2 conjugating enzyme
3l1z	Crystal structure of the U-BOX domain of human E4B ubiquitin ligase in complex with UBCH5C E2 ubiquitin conjugating enzyme
3o2u	S. cerevisiae Ubc12
3obq	Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3obs	Crystal structure of Tsg101 UEV domain
3obu	Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3obx	Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3oj4	Crystal structure of the A20 ZnF4, ubiquitin and UbcH5A complex
3ong	Crystal structure of UBA2ufd-Ubc9: insights into E1-E2 interactions in Sumo pathways
3p9g	Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3p9h	Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
3ptf	X-ray structure of the non-covalent complex between UbcH5A and Ubiquitin
3r3q	Crystal structure of the yeast Vps23 UEV domain
3r42	Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide
3rcz	Rad60 SLD2 Ubc9 Complex
3rpg	Bmi1/Ring1b-UbcH5c complex structure
3rz3	Human Cdc34 E2 in complex with CC0651 inhibitor
3sqv	Crystal Structure of E. coli O157:H7 E3 ubiquitin ligase, NleL, with a human E2, UbcH7
3sy2	Crystal structure of the Salmonella E3 ubiquitin ligase SopA in complex with the human E2 UbcH7
3tgd	Crystal structure of the human ubiquitin-conjugating enzyme (E2) UbcH5b
3ugb	UbcH5c~Ubiquitin Conjugate
3uin	Complex between human RanGAP1-SUMO2, UBC9 and the IR1 domain from RanBP2
3uio	Complex between human RanGAP1-SUMO2, UBC9 and the IR1 domain from RanBP2 containing IR2 Motif II
3uip	Complex between human RanGAP1-SUMO1, UBC9 and the IR1 domain from RanBP2 containing IR2 Motif II
3von	Crystalstructure of the ubiquitin protease
3w31	Structual basis for the recognition of Ubc13 by the Shigella flexneri effector OspI
3we5	3WE5
3zni	Structure of phosphoTyr363-Cbl-b - UbcH5B-Ub - ZAP-70 peptide complex
4a49	Structure of phosphoTyr371-c-Cbl-UbcH5B complex
4a4b	Structure of modified phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4a4c	Structure of phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4ap4	Rnf4 - ubch5a - ubiquitin heterotrimeric complex
4auq	Structure of BIRC7-UbcH5b-Ub complex.
4bvu	Structure of Shigella effector OspG in complex with host UbcH5c- Ubiquitin conjugate
4bwf	Pex4p-Pex22p disulphide bond mutant
4ccg	Structure of an E2-E3 complex
4ddg	Crystal structure of human OTUB1/UbcH5b~Ub/Ub
4ddi	Crystal structure of human OTUB1/UbcH5b~Ub/Ub
4dhi	Structure of C. elegans OTUB1 bound to human UBC13
4dhj	The structure of a ceOTUB1 ubiquitin aldehyde UBC13~Ub complex
4dhz	The structure of h/ceOTUB1-ubiquitin aldehyde-UBC13~Ub
4ds2	Ubiquitin conjugating enzyme (putative) from Trypanosoma cruzi
4eje	Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
4fh1	S. cerevisiae Ubc13-N79A
4gpr	Crystal structure of EhUbc5, a ubiquitin conjugating enzyme from Entamoeba histolytica
4ii2	Crystal structure of Ubiquitin activating enzyme 1 (Uba1) in complex with the Ub E2 Ubc4, ubiquitin, and ATP/Mg
4ip3	Complex structure of OspI and Ubc13
4jqu	Crystal structure of Ubc7p in complex with the U7BR of Cue1p
4jue	Crystal structure of Plasmodium falciparum ubiquitin conjugating enzyme UBC9
4l83	Structure of a putative Ubiquitin-conjugating enzyme E2 from Brugia malayi
4lad	Crystal Structure of the Ube2g2:RING-G2BR complex
4ldt	The structure of h/ceOTUB1-ubiquitin aldehyde-UBCH5B~Ub
4m1n	Crystal structure of Plasmodium falciparum ubiquitin conjugating enzyme UBC9
4mdk	Cdc34-ubiquitin-CC0651 complex
4nr3	4NR3
4nrg	4NRG
4nri	4NRI
4onl	4ONL
4onm	4ONM
4onn	4ONN
4orh	Crystal structure of RNF8 bound to the UBC13/MMS2 heterodimer
4p5o	4P5O
4q5e	4Q5E
4q5h	4Q5H
4qpl	4QPL
4r62	4R62
4r8p	4R8P
4s3o	4S3O
4tkp	4TKP
4v3k	4V3K
4v3l	4V3L
4w5v	4W5V
4whv	4WHV
4wz3	4WZ3
4x57	4X57
4y1l	4Y1L
4yc1	4YC1
4yii	4YII
4zny	4ZNY
5a31	5A31
5a4p	5A4P
5aie	5AIE
5ait	5AIT
5aiu	5AIU
5bnb	5BNB
5d0k	5D0K
5d0m	5D0M
5d1k	5D1K
5d1l	5D1L
5d1m	5D1M
5d2m	5D2M
5dfl	5DFL
5edv	5EDV
5egg	5EGG
5eya	5EYA
5f6d	5F6D
5f6e	5F6E
5f6u	5F6U
5f6v	5F6V
5f6w	5F6W
5f6x	5F6X
5f6y	5F6Y
5fer	5FER
5fq2	5FQ2
5hpt	5HPT
5ifr	5IFR
5jne	5JNE
5khr	5KHR
5l9t	5L9T
5l9u	5L9U

Links (links to other resources describing this domain)

• PFAM: UQ_con