The domain within your query sequence starts at position 2 and ends at position 78; the E-value for the UreE_C domain shown below is 9e-50.

LVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSA
RCAQFPRAQDKVHYYIK

The domain was found using the schnipsel database

UreE_C

UreE urease accessory protein, C-terminal domain
UreE_C
SMART accession number:SM00987
Description: UreE is a urease accessory protein. Urease hydrolyses urea into ammonia and carbamic acid. The C-terminal region of members of this family contains a His rich Nickel binding site.
Family alignment:
View or

There are 48577 UreE_C domains in 48571 proteins in SMART's nrdb database.

Click on the following links for more information.