The domain within your query sequence starts at position 834 and ends at position 867; the E-value for the VRR_NUC domain shown below is 2e-12.

IHGEGSTFSTLCGLLLWDIIFMDGIPDVFRNAYQ

The domain was found using the schnipsel database

VRR_NUC

VRR_NUC
SMART accession number:SM00990
Description: This entry contains proteins with the VRR-NUC domain. It is associated with members of the PD-(D/E)XK nuclease superfamily, which include the type III restriction modification enzymes, for example StyLTI.
Interpro abstract (IPR014883):

This entry contains proteins with the VRR-NUC domain. It is associated with members of the PD-(D/E)XK nuclease superfamily, which include the type III restriction modification enzymes [ (PUBMED:15972856) ].

GO function:hydrolase activity, acting on ester bonds (GO:0016788)
Family alignment:
View or

There are 7433 VRR_NUC domains in 7432 proteins in SMART's nrdb database.

Click on the following links for more information.