The domain within your query sequence starts at position 53 and ends at position 109; the E-value for the VWC_def domain shown below is 2e-35.

CVDDSGFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPEC

The domain was found using the schnipsel database

VWC_def

• SMART accession number: SM00011
• Description: -

There are 8911 VWC_def domains in 4732 proteins in SMART's nrdb database.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
25.00	map04610	Complement and coagulation cascades
25.00	map04512	ECM-receptor interaction
25.00	map04510	Focal adhesion
6.25	map00680	Methane metabolism
6.25	map00940	Phenylpropanoid biosynthesis
6.25	map04350	TGF-beta signaling pathway
6.25	map00360	Phenylalanine metabolism

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with VWC_def domain which could be assigned to a KEGG orthologous group, and not all proteins containing VWC_def domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.