The domain within your query sequence starts at position 267 and ends at position 346; the E-value for the C8 domain shown below is 2.3e-10.

QAQAQDMCHQLLEGPFWQCHGQVQPDEYHETCLFAYCVGATAGNGPEGQLEAVCATFANY
AQACARQHIYVHWRKPGFCE

C8

C8
SMART accession number:SM00832
Description: This domain contains 8 conserved cysteine residues, but this family only contains 7 of them to overlaps with other domains. It is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin.
Interpro abstract (IPR014853):

The proteins in this entry contained a domain rich in positionally conserved cysteine residues. Most proteins contains 7 or 8 cysteine residues. The domain is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin. It is often found on proteins containing IPR001846 and IPR002919 .

Family alignment:
View or

There are 20065 C8 domains in 7663 proteins in SMART's nrdb database.

Click on the following links for more information.