The domain within your query sequence starts at position 36 and ends at position 108; the E-value for the CAD domain shown below is 2.16e-41.
RPFRVCDHKRTVRKGLTAASLQELLDKVLETLLLRGVLTLVLEEDGTAVDSEDFFQLLED DTCLMVLEQGQSW
CADDomains present in proteins implicated in post-mortem DNA fragmentation |
---|
SMART accession number: | SM00266 |
---|---|
Description: | - |
Interpro abstract (IPR003508): | The CIDE-N or CAD domain is a ~78 amino acid protein-protein interaction domain in the N-terminal part of Cell death-Inducing DFF45-like Effector (CIDE) proteins, involved in apoptosis. At the final stage of programmed cell death, chromosomal DNA is degraded into fragments by Caspase-activated DNase (CAD), also named DNA fragmentation factor 40kDa (DFF40). In normal cells CAD/DFF40 is completely inhibited by its binding to DFF45 or Inhibitor of CAD (ICAD). Apoptotic stimuli provoke cleavage of ICAD/DFF45 by caspases, resulting in self-assembly of CAD/DFF40 into the active dimer [ (PUBMED:15149602) ]. Both CAD/DFF40 and ICAD/DFF45 possess an N-terminal CIDE-N domain that is involved in their interaction. The name of the CIDE-N domain refers to the CIDE proteins and CAD, where the domain forms the N-terminal part [ (PUBMED:9564035) (PUBMED:10619428) ]. The CIDE-N domains from different proteins can interact, e.g. CIDE-N of CIDE-B and ICAD/DFF45 with CIDE-N of CAD/DFF40, and such interactions can also be needed for proper folding [ (PUBMED:10764577) (PUBMED:11371636) ]. Tertiary structures show that the CIDE-N domain forms an alpha/beta roll fold of five beta-strands forming a single, mixed parallel/anti-parallel beta-sheet with one [ (PUBMED:10764577) ] or two [ (PUBMED:10619428) (PUBMED:11371636) ] alpha-helices packed against the sheet. Binding surfaces of the CIDE-N domain form a central hydrophobic cluster, while specific binding interfaces can be formed by charged patches. Some proteins known to contain a CIDE-N domain include:
|
GO process: | apoptotic process (GO:0006915) |
Family alignment: |
There are 1356 CAD domains in 1355 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)