The domain within your query sequence starts at position 1 and ends at position 128; the E-value for the CDC37_N domain shown below is 1.07e-69.

MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAESDGQVELERLRAEAQQLRKEERSWEQKLEDMRKKEKNMPWNVDTL
SKDGFSKS

CDC37_N

Cdc37 N terminal kinase binding
CDC37_N
SMART accession number:SM01071
Description: Cdc37 is a molecular chaperone required for the activity of numerous eukaryotic protein kinases. This domain corresponds to the N terminal domain which binds predominantly to protein kinases (PUBMED:16098195) and is found N terminal to the Hsp (Heat shocked protein) 90-binding domain. Expression of a construct consisting of only the N-terminal domain of Saccharomyces pombe Cdc37 results in cellular viability. This indicates that interactions with the cochaperone Hsp90 may not be essential for Cdc37 function (PUBMED:16098195).
Interpro abstract (IPR013855):

Cdc37 is a molecular chaperone required for the activity of numerous eukaryotic protein kinases. This entry corresponds to the N-terminal kinase binding domain of these proteins [ (PUBMED:16098195) ]. It is found N-terminal to a Hsp90 chaperone (heat shock protein 90) binding domain ( IPR013874 ). Expression of a construct consisting of only the N-terminal domain of Saccharomyces pombe Cdc37 has been shown to result in cellular viability. This indicates that interactions with the cochaperone Hsp90 may not be essential for Cdc37 function [ (PUBMED:16098195) ].

GO function:protein kinase binding (GO:0019901)
Family alignment:
View or

There are 1435 CDC37_N domains in 1433 proteins in SMART's nrdb database.

Click on the following links for more information.