The domain within your query sequence starts at position 1591 and ends at position 1888; the E-value for the CNH domain shown below is 1.78e-112.

LDMNCTLPFSDQVVLVGTEEGLYALNVLKNSLTHIPGIGAVFQIYIIKDLEKLLMIAGEE
RALCLVDVKKVKQSLAQSHLPAQPDVSPNIFEAVKGCHLFAAGKIENSLCICAAMPSKVV
ILRYNDNLSKYCIRKEIETSEPCSCIHFTNYSILIGTNKFYEIDMKQYTLDEFLDKNDHS
LAPAVFASSSNSFPVSIVQANSAGQREEYLLCFHEFGVFVDSYGRRSRTDDLKWSRLPLA
FAYREPYLFVTHFNSLEVIEIQARSSLGSPARAYLEIPNPRYLGPAISSGAIYLASSY

CNH

Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2

• SMART accession number: SM00036
• Description: Unpublished observations.
• Interpro abstract (IPR001180):

  Based on sequence similarities a domain of homology has been identified in the following proteins [ (PUBMED:10391936) ]:

  • Citron and Citron kinase. These two proteins interact with the GTP-bound forms of the small GTPases Rho and Rac but not with Cdc42.
  • Myotonic dystrophy kinase-related Cdc42-binding kinase (MRCKalpha). This serine/threonine kinase interacts with the GTP-bound form of the small GTPase Cdc42 and to a lesser extent with that of Rac.
  • NCK Interacting Kinase (NIK), a serine/threonine protein kinase.
  • ROM-1 and ROM-2, from yeast. These proteins are GDP/GTP exchange proteins (GEPs) for the small GTP binding protein Rho1.

  This domain, called the citron homology domain, is often found after cysteine rich and pleckstrin homology (PH) domains at the C-terminal end of the proteins [ (PUBMED:10391936) ]. It acts as a regulatory domain and could be involved in macromolecular interactions [ (PUBMED:10391936) (PUBMED:9135144) ].

There are 9359 CNH domains in 9356 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Binding / catalysis: unknown

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Madaule P et al.
• A novel partner for the GTP-bound forms of rho and rac.
• FEBS Lett. 1995; 377: 243-8

Using the yeast two hybrid system and overlay assays we identified a putative rholrac effector, citron, which interacts with the GTP-bound forms of rho and rac1, but not with cdc42. Extensive homologies to known proteins were not observed. This 183 kDa protein contains a C6H2 zinc finger, a PH domain, and a long coiled-coil forming region including 4 leucine zippers and the rholrac binding site. We recently identified three others putative rho effectors characterized by a common rho binding motif. Citron does not share this motif and displays a distinctive protein organization, thus defining a separate class of rho partners.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
100.00	map04010	MAPK signaling pathway

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with CNH domain which could be assigned to a KEGG orthologous group, and not all proteins containing CNH domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Links (links to other resources describing this domain)

• INTERPRO: IPR001180