The domain within your query sequence starts at position 1508 and ends at position 1738; the E-value for the COLFI domain shown below is 7.98e-92.

LEEVMASLNSLSLELQQLQRPLGTAESPGLMCRELHRDHPHLPDGEYWIDPNQGCARDAF
KVFCNFTAGGETCLYPDKKFETVKLASWSREKPGGWYSTFRRGKKFSYVDADGSPVNVVQ
LTFLKLLSAAAHQRFTYICQNSVAWLDEAAGDHRHSIRFQGTNWEELSFNQTTAATIKVS
HDGCRVRKGQAKTLFEFSSSVGFLPLWDVAASDFGQTNQKFGFELGSICFS

COLFI

Fibrillar collagens C-terminal domain
COLFI
SMART accession number:SM00038
Description: Found at C-termini of fibrillar collagens: Ephydatia muelleri procollagen EMF1alpha, vertebrate collagens alpha(1)III, alpha(1)II, alpha(2)V etc.
Interpro abstract (IPR000885):

Collagens contain a large number of globular domains in between the regions of triple helical repeats IPR008160 . These domains are involved in binding diverse substrates. One of these domains is found at the C terminus of fibrillar collagens. The exact function of this domain is unknown.

GO function:extracellular matrix structural constituent (GO:0005201)
Family alignment:
View or

There are 5907 COLFI domains in 5904 proteins in SMART's nrdb database.

Click on the following links for more information.