The domain within your query sequence starts at position 91 and ends at position 219; the E-value for the CactinC_cactus domain shown below is 8.29e-35.
KEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHR FMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF HFKMEKPPA
CactinC_cactusCactus-binding C-terminus of cactin protein |
---|
SMART accession number: | SM01050 |
---|---|
Description: | CactinC_cactus is the C-terminal 200 residues of the cactin protein which are necessary for the association of cactin with IkappaB-cactus as one of the intracellular members of the Rel complex. The Rel (NF-kappaB) pathway is conserved in invertebrates and vertebrates. In mammals, it controls the activities of the immune and inflammatory response genes as well as viral genes, and is critical for cell growth and survival. In Drosophila, the Rel pathway functions in the innate cellular and humoral immune response, in muscle development, and in the establishment of dorsal-ventral polarity in the early embryo (PUBMED:10842059). Most members of the family also have a Cactin_mid domain further upstream. |
Family alignment: |
There are 2979 CactinC_cactus domains in 2978 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Links (links to other resources describing this domain)