The domain within your query sequence starts at position 251 and ends at position 362; the E-value for the Calx_beta domain shown below is 2.33e-2.

VEIIVKKNDSPVNFMQSVYVVPEDDHVLTIPVLRGKDSDGNLIGSDETQVSIRYKVMTWD
STAHAQQNVDFIDLQPDTTLVFPPFVHESHLKFQIIDDLIPEIAESFHIMLL

Calx_beta

Domains in Na-Ca exchangers and integrin-beta4
Calx_beta
SMART accession number:SM00237
Description: Domain in Na-Ca exchangers and integrin subunit beta4 (and some cyanobacterial proteins)
Interpro abstract (IPR003644):

The calx-beta motif is present as a tandem repeat in the cytoplasmic domains of Calx Na-Ca exchangers, which are used to expel calcium from cells. This motif overlaps domains used for calcium binding and regulation. The calx-beta motif is also present in the cytoplasmic tail of mammalian integrin-beta4, which mediates the bi-directional transfer of signals across the plasma membrane, as well as in some cyanobacterial proteins. This motif contains a series of beta-strands and turns that form a self-contained beta-sheet [ (PUBMED:9294196) (PUBMED:10390612) ].

GO process:cell communication (GO:0007154)
GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 22869 Calx_beta domains in 5347 proteins in SMART's nrdb database.

Click on the following links for more information.