The domain within your query sequence starts at position 33 and ends at position 142; the E-value for the Cg6151-P domain shown below is 2.87e-61.

AGVLGAVSCAISGLFNCVTIHPLNIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKV
DRLRSWQKAVFYCGMAIVPIVMSLTLTTLLGNAIAFATGVLYGLSALGKK

Cg6151-P

Uncharacterized conserved protein CG6151-P
Cg6151-P
SMART accession number:SM01077
Description: This is a family of small, less than 200 residue long, proteins which are named as CG6151-P proteins that are conserved from fungi to humans. The function is unknown. The fungal members have a characteristic ICP sequence motif. Some members are annotated as putative clathrin-coated vesicle protein but this could not be defined.
Interpro abstract (IPR019365):

This is a family of small (less than 200 residue long) proteins that are conserved from fungi to humans. Family members include the TVP18 Golgi membrane proteins that are involved in vesicular trafficking [ (PUBMED:17178117) ] and the calcium channel flower proteins, which form calcium channels that regulate synaptic endocytosis [ (PUBMED:19737521) ].

GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 1212 Cg6151-P domains in 1212 proteins in SMART's nrdb database.

Click on the following links for more information.