The domain within your query sequence starts at position 53 and ends at position 118; the E-value for the Cg6151-P domain shown below is 8.02e-10.
CAISGLFNCVTIHPLNIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRLRSWQK AVFYCG
Cg6151-PUncharacterized conserved protein CG6151-P |
---|
SMART accession number: | SM01077 |
---|---|
Description: | This is a family of small, less than 200 residue long, proteins which are named as CG6151-P proteins that are conserved from fungi to humans. The function is unknown. The fungal members have a characteristic ICP sequence motif. Some members are annotated as putative clathrin-coated vesicle protein but this could not be defined. |
Interpro abstract (IPR019365): | This is a family of small (less than 200 residue long) proteins that are conserved from fungi to humans. Family members include the TVP18 Golgi membrane proteins that are involved in vesicular trafficking [ (PUBMED:17178117) ] and the calcium channel flower proteins, which form calcium channels that regulate synaptic endocytosis [ (PUBMED:19737521) ]. |
GO component: | integral component of membrane (GO:0016021) |
Family alignment: |
There are 1212 Cg6151-P domains in 1212 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)