The domain within your query sequence starts at position 43 and ends at position 272; the E-value for the CoA_trans domain shown below is 2.17e-79.

YTDPVKAVEGVKDGSTVMLGGFGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGIL
LASKQVRRVVCSYLGENALCEKLYLAGELELEMTPQGTLAERIRAGGTGVPAFYTPTGYG
TLVQEGGSPIRYAPDGHLITLSEPREVREFQGRFYLLEHAIRADFALIKGWKADRSGNVI
FRGSARNFNVPMCKAADISVVEVEEIVDVGTFAPEDIHVPNIYVDRVIKG

CoA_trans

Coenzyme A transferase
CoA_trans
SMART accession number:SM00882
Description: Coenzyme A (CoA) transferases belong to an evolutionary conserved family of enzymes catalyzing the reversible transfer of CoA from one carboxylic acid to another. They have been identified in many prokaryotes and in mammalian tissues. The bacterial enzymes are heterodimer of two subunits (A and B) of about 25 Kd each while eukaryotic SCOT consist of a single chain which is colinear with the two bacterial subunits.
Interpro abstract (IPR004165):

CoA-transferases are found in organisms from all kingdoms of life. They catalyse reversible transfer reactions of coenzyme A groups from CoA-thioesters to free acids. There are at least three families of CoA-transferases, which differ in sequence and reaction mechanism:

  • Family I consists of CoA-transferases for 3-oxoacids ( EC 2.8.3.5 EC 2.8.3.6 ), short-chain fatty acids ( EC 2.8.3.8 EC 2.8.3.9 ) and glutaconate ( EC 2.8.3.12 ). Most use succinyl-CoA or acetyl-CoA as CoA donors.
  • Family II consists of the homodimeric alpha-subunits of citrate lyase and citramalate lyase ( EC 2.8.3.10 EC 2.8.3.11 ). These enzymes catalyse the transfer of acyl carrier protein (ACP) with a covalently bound CoA derivative, but can accept free CoA thioesters as well.
  • Family III consists of formyl-CoA:oxalate CoA-transferase [ (PUBMED:15213226) ], succinyl-CoA:(R)-benzylsuccinate CoA-transferase [ (PUBMED:11418570) ], (E)-cinnamoyl-CoA:(R)-phenyllactate CoA-transferase [ (PUBMED:10849007) ], succinyl-CoA:mesaconate CoA-transferase [ (PUBMED:28932214) ] and butyrobetainyl-CoA:(R)-carnitine CoA-transferase [ (PUBMED:15823031) ]. These CoA-transferases occur in prokaryotes and eukaryotes, and catalyse CoA-transfer reactions in a highly substrate- and stereo-specific manner [ (PUBMED:11749953) ].

Coenzyme A (CoA) transferases belong to an evolutionary conserved [ (PUBMED:1624453) (PUBMED:9325289) ] family of enzymes catalyzing the reversible transfer of CoA from one carboxylic acid to another. They have been identified in many prokaryotes and in mammalian tissues. The bacterial enzymes are heterodimer of two subunits (A and B) of about 25 Kd each while eukaryotic SCOT consist of a single chain which is colinear with the two bacterial subunits.

This family consists of 3-oxoacid CoA-transferases and related CoA-transferases from family I.

GO function:CoA-transferase activity (GO:0008410)
Family alignment:
View or

There are 43359 CoA_trans domains in 40171 proteins in SMART's nrdb database.

Click on the following links for more information.