The domain within your query sequence starts at position 706 and ends at position 766; the E-value for the DBP10CT domain shown below is 1.45e-25.

DLMGDEAQNMSRGQQQLKWDRKKKRFVGQSGQEDKKKIKTESGRFISSSYKRDLYQKWKQ
K

DBP10CT

DBP10CT (NUC160) domain
DBP10CT
SMART accession number:SM01123
Description: This C terminal domain is found in the Dbp10p subfamily of hypothetical RNA helicases ((PUBMED:15112237)).
Interpro abstract (IPR012541):

This C-terminal domain is found in the Dbp10p subfamily of hypothetical RNA helicases [ (PUBMED:15112237) ].

GO component:nucleus (GO:0005634)
GO function:ATP binding (GO:0005524), RNA binding (GO:0003723), RNA helicase activity (GO:0003724)
Family alignment:
View or

There are 1552 DBP10CT domains in 1552 proteins in SMART's nrdb database.

Click on the following links for more information.