The domain within your query sequence starts at position 20 and ends at position 128; the E-value for the DBR1 domain shown below is 4.22e-27.

MQHQATDKDQAGKETKFLALDKCLPHRDFLQVLEIEHDPSAPEYLEYDVEWLTVLRATDD
LINVTGGLWNMPEDNGLHTRCVCSLRACLLPCMCSVVSHLCCVLIPEEF

DBR1

Lariat debranching enzyme, C-terminal domain
DBR1
SMART accession number:SM01124
Description: This presumed domain is found at the C-terminus of lariat debranching enzyme. This domain is always found in association with Metallophos PF00149.
Interpro abstract (IPR007708):

This presumed domain is found at the C terminus of lariat debranching enzyme. This domain is always found in association with a metallo-phosphoesterase domain IPR004843 . RNA lariat debranching enzyme is capable of digesting a variety of branched nucleic acid substrates and multicopy single-stranded DNAs. The enzyme degrades intron lariat structures during splicing.

GO process:mRNA processing (GO:0006397)
GO function:hydrolase activity, acting on ester bonds (GO:0016788)
Family alignment:
View or

There are 1708 DBR1 domains in 1705 proteins in SMART's nrdb database.

Click on the following links for more information.