The domain within your query sequence starts at position 116 and ends at position 304; the E-value for the DDRGK domain shown below is 8.35e-113.
GKIGAKKLRKLEEKQARKAQREAEEAEREERKRLESQREAEWKKEEERLRLKEEQKEEEE RKAQEEQARREHEEYLKLKEAFVVEEEGVSETMTEEQSHSFLTEFINYIKKSKVVLLEDL AFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPEELAAVANFIRQRGRVSITEL AQASNSLIS
DDRGK |
---|
SMART accession number: | SM01128 |
---|---|
Description: | This is a family of proteins of approximately 300 residues, found in plants and vertebrates. They contain a highly conserved DDRGK motif. |
Interpro abstract (IPR019153): | This is a family of proteins of approximately 300 residues. They contain a highly conserved DDRGK motif. The function is unknown. |
Family alignment: |
There are 1020 DDRGK domains in 1020 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)